KEGG   Sebaldella termitidis: Sterm_2946Help
Entry
Sterm_2946        CDS       T01123                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
str  Sebaldella termitidis
Pathway
str00230  Purine metabolism
str01100  Metabolic pathways
Module
str_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:str00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Sterm_2946
Enzymes [BR:str01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Sterm_2946
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 AAA_22 ABC_tran dNK AAA_16 Rad17 Cytidylate_kin RsgA_GTPase AAA_17 RNA_helicase Zeta_toxin AAA_29 PRK T2SSE CPT APS_kinase AAA_30
Motif
Other DBs
NCBI-ProteinID: ACZ09789
UniProt: D1ANI5
Position
complement(3086538..3087083)
Genome map
AA seq 181 aa AA seqDB search
MKGKLIVVSGPSGAGKSTVTKIARDKLHIPLTISATTRKPRQDETDGKDYYFLTEEEFMK
RVNNDEFFEWAKVHDNYYGTLKSEVEKKREEGNTVLLEIDVQGGLIVKKKDPSAVLVFFK
APDDKELEGRLRNRGSDSEEIIRKRLENALKEMEYEKEYDYSIINISIDQSYQELSDIIN
H
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaaggggaaactaatagtagtatcaggtccaagcggagcgggtaaatctacagttaca
aaaatagcgagagataaattacatatacctttaacaatatcagcaacgacaagaaaaccc
agacaggacgaaacagacggaaaagattattactttttaacagaagaagaatttatgaaa
agagtaaataatgatgagttttttgaatgggcaaaagttcatgataattattacggtact
ttgaaatctgaagtagaaaagaaaagggaagaaggaaatacagttttgctggagatagat
gtacagggcggtttgatagtaaagaaaaaggatccaagtgctgtattagttttttttaaa
gctcctgatgataaagagctggaaggaaggctgagaaatagaggctctgattctgaggaa
ataataagaaaaagactggaaaatgctctaaaagaaatggaatatgaaaaggaatatgat
tattctattataaatatcagtatagaccagtcatatcaggaattatcagatattattaat
cattag

DBGET integrated database retrieval system