KEGG   Sebaldella termitidis: Sterm_3303Help
Entry
Sterm_3303        CDS       T01123                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
str  Sebaldella termitidis
Pathway
str00400  Phenylalanine, tyrosine and tryptophan biosynthesis
str01100  Metabolic pathways
str01110  Biosynthesis of secondary metabolites
str01130  Biosynthesis of antibiotics
str01230  Biosynthesis of amino acids
Module
str_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:str00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sterm_3303
Enzymes [BR:str01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Sterm_3303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ACZ10143
UniProt: D1APV9
Position
3476844..3477578
Genome map
AA seq 244 aa AA seqDB search
MSNILHKIKLEREKQLSEEKKILSKPSLIKALKKDGIQIIGEIKRASPSKGTIAKDTFDI
EKQLDYYVKNNIAAFSILTENHFFKGQNEDLTFAGKLHPEIPVLRKDFIFDPFQVAQAKF
IGASAVLLIVKMLSDIELINLHKLALDLELEVLVEIHNEEDLERALRIPEIKLLGINNRN
LDTFETSLSVTENLFPKIPAGKDITIISESGVHTQEDLKFLESIGVDGVLIGESLMKTSL
LNPK
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatatactgcataaaatcaagctggaaagggaaaaacagctttcagaggaaaaa
aaaatactttcaaagccgtcgcttataaaagctttgaagaaagacggcattcagataata
ggtgagataaaaagagcttctccgtccaaagggactattgcaaaagatacctttgacata
gaaaaacagctcgattattatgtaaaaaacaatatcgcagctttttcaatcctgacagaa
aatcatttttttaaaggacaaaatgaagacctcacttttgcgggaaagcttcatcctgaa
atacctgtattaagaaaggattttattttcgatccgtttcaggtggcacaggcaaaattt
ataggagcaagcgcagtactgctaatagtaaaaatgctttcagatattgaacttattaat
cttcataaactggctcttgatctggagctggaagtgcttgtggaaattcataatgaagaa
gatctggaaagagctttaagaatcccggaaattaagcttttgggaattaacaacagaaat
cttgatacctttgaaacttcgctttctgtaacagaaaatctttttccaaaaattcctgcc
ggaaaagatattactattataagtgaaagcggggttcatacacaggaagatttaaaattt
ttagaatctataggtgttgacggagtccttataggggaatcgcttatgaaaaccagtctt
ttgaatccaaaataa

DBGET integrated database retrieval system