KEGG   Sebaldella termitidis: Sterm_3306Help
Entry
Sterm_3306        CDS       T01123                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
str  Sebaldella termitidis
Pathway
str00260  Glycine, serine and threonine metabolism
str00400  Phenylalanine, tyrosine and tryptophan biosynthesis
str01100  Metabolic pathways
str01110  Biosynthesis of secondary metabolites
str01130  Biosynthesis of antibiotics
str01230  Biosynthesis of amino acids
Module
str_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:str00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sterm_3306
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sterm_3306
Enzymes [BR:str01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sterm_3306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth BtpA PcrB NMO
Motif
Other DBs
NCBI-ProteinID: ACZ10146
UniProt: D1AQ86
Position
3479386..3480144
Genome map
AA seq 252 aa AA seqDB search
MNKLQNIFKDKKNVNIGYIVGGFPNIDYTRKFLLNLKKSPIDILEIGIPYSDPIADGKII
SEASFKASQNNITPDTVFDLLISEKENIHTPLVFLIYYNLIFAYGIDHFIKKSVEAGITG
LVIPDLPYEEAQELIEKLNKNNIAFIPLISVTSQNRIPKLVSQGSGFIYAIASLGVTGTK
QVSPDRLTEFIHEIKKYTDLPVAIGFGIKNREDIIKLRNSADGLIVGTSIVRLTESYTPD
EVVPKLEELFVV
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaataagctgcaaaatatttttaaagacaagaaaaatgtaaatatcggatatatagta
ggcggttttccaaatattgattataccagaaagtttcttctgaatctgaaaaaatcacct
atagatattctggaaataggtattccctattccgatcccatagctgacggaaaaataatt
tcagaagcttcctttaaagcttcacagaataatattactcctgacacagtttttgacctt
ttaatttctgaaaaggaaaatatacatactccccttgtgtttttaatttattataatctt
atttttgcttacggaattgatcattttataaaaaaatccgtagaagcaggcataacagga
cttgtaattcctgatctgccgtatgaagaggcacaggagcttattgagaagcttaataaa
aataatattgcctttattcctcttataagcgttacttcacaaaaccggattccaaaactg
gtttcacagggaagcggttttatatatgctattgcatcacttggcgttactggaacaaaa
caggtttctccggacagacttactgaatttatacacgagataaaaaagtatactgatctt
cctgttgctataggctttggaataaaaaacagggaagatataataaagctgcgtaactcg
gcagacggtctgatagtgggaacctctatagtccggctgacagaaagctatactcctgat
gaggtagttcccaagctggaggagttattcgttgtatag

DBGET integrated database retrieval system