KEGG   Sebaldella termitidis: Sterm_3604Help
Entry
Sterm_3604        CDS       T01123                                 

Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
str  Sebaldella termitidis
Pathway
str00540  Lipopolysaccharide biosynthesis
str01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:str00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    Sterm_3604
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:str01005]
    Sterm_3604
Enzymes [BR:str01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     Sterm_3604
Lipopolysaccharide biosynthesis proteins [BR:str01005]
 Unusual sugar
  Sterm_3604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 Phage_Gp15
Motif
Other DBs
NCBI-ProteinID: ACZ10438
UniProt: D1ARF2
Position
complement(3827075..3828055)
Genome map
AA seq 326 aa AA seqDB search
MIIVTGAAGFIGSAFVWQLNEMGIEDIIVSDKLRTEEKWLNLAKRKYYDWVDKDKLFDYL
ETTAEKITAIIHMGACSATTEKDMDFLMENNYEYTKKLWDYSVKNDAVFIYASSAATYGD
GELGYDDEIGLEGHNALRPLNKYGYSKKIFDVWALKQEKTPKKWFGLKYFNVYGPQEYHK
GRMASMVFHAFNQYNAEKEVKLFKSHKDGYKDGYQLRDFVYIKDVTNVMYFLMKEINAPS
GVYNLGTGSARAFYELAKSTVEAADGDAGKIKFVDMPEDLRGKYQYFTEAKIDKLKKAGY
SRDFTSLEDGVKDYVQNYLMKEDKYL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgataatagttactggagcagcaggatttataggaagtgcctttgtatggcagctgaat
gaaatgggaatagaggatatcatagtttcggataagctcagaacagaggaaaaatggctg
aatcttgccaagagaaaatattacgactgggttgataaggataagctgtttgattatctg
gaaacaacagctgagaagataacagcgattattcatatgggagcatgttctgcaacaact
gaaaaagatatggattttcttatggaaaataactatgaatatacaaaaaaactttgggat
tattcggtaaaaaatgatgcggttttcatatatgcaagcagtgctgctacatatggagac
ggtgagcttggctatgatgacgaaataggtcttgaagggcataatgcactaagaccgtta
aataaatacggttattccaaaaagatttttgatgtatgggctttaaagcaggaaaaaact
ccgaaaaaatggttcggactaaaatattttaatgtatacggacctcaggaatatcataaa
ggaagaatggcaagtatggtttttcatgctttcaatcaatataatgcagaaaaagaagta
aaactttttaaatcgcataaagacggatataaagacggatatcagcttagagactttgta
tatataaaagatgttacgaatgtaatgtactttcttatgaaagagatcaatgcccctagc
ggtgtttataaccttggaacaggcagtgcaagagctttctatgaattagctaaatctaca
gtggaagcagcagacggagatgcaggcaagattaagtttgtagatatgcctgaggatttg
agaggaaagtatcagtattttacagaggcaaagatagataaattgaaaaaagccggttac
agcagagattttacctctttggaagacggagtaaaagattatgtacagaattatcttatg
aaagaggataagtatctgtaa

DBGET integrated database retrieval system