KEGG   Sebaldella termitidis: Sterm_3606Help
Entry
Sterm_3606        CDS       T01123                                 

Definition
(GenBank) PHP domain protein
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
str  Sebaldella termitidis
Brite
KEGG Orthology (KO) [BR:str00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Sterm_3606
Enzymes [BR:str01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     Sterm_3606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: ACZ10440
UniProt: D1ARF4
Position
complement(3828578..3829417)
Genome map
AA seq 279 aa AA seqDB search
MVDLHMHSLYSDGTFSVSELVKRSGEKGIKILSLTDHDTVEGLAEAAKECIENNIKFING
IEISTEYKGKEVHILGYFIDEKDKSLIDFSNEMKQARINRNEKAIKILNNHGIEITKEDT
FREAEGVIISRTHLARALIAKGYVKDVKEAFSKYLGSNGLAYVPKSNLNPFDGIEIIKKS
GGLAFLAHPKLIGLEEEDFVRLVKDMKDHGLDGIETYYSLFSKEDMKYFEKIAEKFSLIR
SAGSDFHGENRKGVDIGDNYAPKELFYIWNELYEQKNKH
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggtagatcttcatatgcattctctatattcagacggaactttcagtgtttctgaatta
gtgaaaagatccggtgaaaagggtataaaaatattgtcgcttacagatcatgacactgtg
gaaggacttgccgaggctgcgaaagagtgcatagaaaataacataaaattcataaacgga
atagagatatctacagaatataaaggaaaagaagtacatatactcggttattttatagat
gagaaagataaaagcctgatagatttttctaatgaaatgaaacaggcaagaatcaacaga
aatgaaaaagctataaaaatactgaataatcatggaatagagattacgaaagaggataca
ttccgtgaggcagaaggagtaattataagcagaacacacctggcaagagctctgatagcc
aaaggttacgtaaaagatgtaaaggaagcatttagcaaatatctgggatcaaacggactt
gcctatgttccaaaatcaaatctgaatccttttgacggaatagagataataaaaaaaagc
ggagggttggcgtttttagcccaccctaagcttataggactggaagaagaagactttgtc
cggcttgtgaaggatatgaaggatcatggactggatggaatagaaacatactattcccta
ttttcaaaggaagatatgaaatactttgaaaaaatagcagaaaaattttctcttataaga
agtgccgggtctgattttcacggtgaaaatagaaaaggtgtggatattggagataattat
gcaccaaaagaacttttttacatctggaatgagctttatgaacaaaaaaacaagcattag

DBGET integrated database retrieval system