KEGG   Streptococcus sp. A12: ATM98_00525Help
Entry
ATM98_00525       CDS       T05522                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
stra  Streptococcus sp. A12
Pathway
stra00450  Selenocompound metabolism
stra00970  Aminoacyl-tRNA biosynthesis
stra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stra00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ATM98_00525
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ATM98_00525
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:stra01007]
    ATM98_00525
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:stra03016]
    ATM98_00525
Enzymes [BR:stra01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     ATM98_00525
Amino acid related enzymes [BR:stra01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   ATM98_00525
Transfer RNA biogenesis [BR:stra03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    ATM98_00525
 Prokaryotic type
   Other AARSs
    ATM98_00525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AMP66270
UniProt: A0A127TQS4
Position
90997..92988
Genome map
AA seq 663 aa AA seqDB search
MTKSFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRMMNYDVFYLTGLDEHGQKIQQKA
EEAGITPQAYVDGMAVGVKELWQLLDISYDKFIRTTDDYHEKVVAQIFERLLAQDDIYLG
EYSGWYSVSDEEFFTESQLAEVYRDENGKVIGGVAPSGHEVEWVSEESYFLRLSKYQDRL
VEFFKSQPDFITPDGRLNEMLKNFIEPGLEDLAVSRTTFTWGVPVPSNPRHVVYVWFDAL
LNYVTALGYGQEDHENFDKFWNGTVFHMVGKDILRFHSIYWPILLMMLDIKLPERLIGHG
WFVMKDGKMSKSKGNVIYPEMLVERFGLDPLRYYLMRSLPVGSDGTFTPEDYVARINYEL
ANDLGNLLNRTVAMINKYFGGQVPAYVENVTAFDADLAKVVEENIAEYHKQMNAVDYPRA
LEAVWNIISRTNKYIDETAPWILAKEDGDKEQLAAVMAHLAASLRVVAHLIQPFMMNTSN
AIMEQLGLGLDFDLENLTLAGFPENVTVVAKGTPIFPRLDMEEEIAYIQSQMTAGKPQEK
EWIPEEVELKSEKDEIKFEDFDKVEIRVAEVKEVERVEGSDKLLRFRLDAGDGEDRQILS
GIAKFYPNEQELVGKKLQIVANLKPRKMMKKYVSQGMILSAEHGGQLTVLTVDPSVPNGS
IIG
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaatcattctacatcacaacccctatctattacccatctggtaaattgcatatt
ggttcagcttatacaaccattgcctgtgacgtcttagctcgttacaaacgcatgatgaac
tacgatgtgttctacctgactggtcttgatgagcacggtcaaaagatccagcagaaagca
gaagaagctgggatcacgccgcaagcttatgtagatgggatggccgttggagtgaaagaa
ctctggcaattactcgatatctcatatgataaattcatccgtacgacagacgattaccat
gaaaaagtggtggcccagatctttgaacgcttgcttgcgcaagacgacatctacctgggt
gaatactctggttggtattcagtatctgatgaagagttctttacagaaagccaattggct
gaggtctaccgtgatgagaatggcaaggtcatcggtggggtagccccatcaggccacgaa
gtagaatgggtttctgaagaatcttatttccttcgcctcagcaaataccaagaccgcttg
gttgagtttttcaaatcccaaccagacttcatcactccagatggccgtctcaatgaaatg
ttgaaaaatttcatcgagccaggtttggaagacttggcagtatctcggactacctttacc
tggggagttccagttccatccaatcctcgacacgttgtctacgtttggtttgatgctctg
cttaactatgtgacagctcttggttatggccaagaagatcatgaaaactttgacaaattc
tggaatggaaccgtcttccacatggtcggaaaagacatccttcgtttccactccatctac
tggccaatccttctcatgatgttggatatcaaattgccagaacgtttgattggccatggt
tggtttgtcatgaaagacggtaagatgtctaagtctaaaggaaatgtcatctacccagaa
atgttggtagaacgctttggcttggatccgcttcgctactacctcatgcgcagtctgcca
gttggttcagatggtacctttacaccagaagactacgtggctcgtatcaactatgaattg
gccaatgaccttggaaacctcctcaaccggacggtagccatgatcaataaatactttggt
ggtcaagttccggcttatgtcgaaaatgtcacagcatttgatgcagatttggccaaggta
gttgaagaaaacatcgctgaataccacaagcaaatgaacgcggttgattacccacgcgct
ttagaagcggtatggaatattatctctcggactaacaaatacatcgatgagactgctcct
tggatcctcgctaaagaagatggtgacaaggaacaattggcagcagtgatggctcactta
gcagctagccttcgtgttgtggctcatttgatccaaccattcatgatgaacacctcaaat
gccattatggaacaacttggcttgggcttggacttcgatcttgaaaacttgaccctagca
ggcttccctgaaaatgtcacagtggttgccaaaggaactccaatcttcccacgtctcgac
atggaagaagaaattgcctacatccaatctcaaatgactgctggaaaaccacaagaaaaa
gaatggattccagaagaagtggaactcaagtctgaaaaagatgagatcaaatttgaagac
tttgacaaggttgaaatccgtgtagcagaagtcaaagaagtggaacgcgtcgaaggatca
gacaaattgcttcgcttccgcctagatgcaggagatggcgaagaccgtcaaatcctttct
ggtatcgcgaaattctatccaaatgaacaagaattggtcggcaagaaactccaaatcgtg
gctaacctcaaaccacggaagatgatgaagaaatatgtcagccaaggcatgattctttcc
gcagaacacggaggtcaattaacagtcttaactgttgatccatctgtcccaaatggaagc
attattggttaa

DBGET integrated database retrieval system