KEGG   Streptococcus sp. A12: ATM98_04990Help
Entry
ATM98_04990       CDS       T05522                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
stra  Streptococcus sp. A12
Pathway
stra00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:stra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ATM98_04990
Enzymes [BR:stra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     ATM98_04990
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     ATM98_04990
    1.1.1.-  
     ATM98_04990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AMP67125
UniProt: A0A127TT52
Position
complement(1012680..1013720)
Genome map
AA seq 346 aa AA seqDB search
METMKAARWHGKKDVRIEEVEVPKVQPHQVKVAVKFTGICGTDLHEYLDGPIFIPTEEHV
YSGQKAPVTLGHEFAGEIVEVGSDVTRVKVGDRVTIEPILAKHNLIGDYNLDPNLNFVGL
AADGGFAKYCVLDGDLVHVIPDSLSYEQAALTEPAAVAVYAVRQSALKTGDTAVIFGLGP
IGLLIVEALRAAGASKIYAVELSPERQAKAEELGAIVVRPEEGESIVEAIHRLTDGGADV
SYEVTGVPVVLGQALAAVHKAGECMVVSIWEREASINPNEFAIQEKTLKGIIAYRHIFPK
VLELMEQGYFSAEKLVTKKIKLENIVQDGFIELTQDKSQIKILVEP
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaatgaaagctgctcgctggcatggcaagaaggacgttcgtatcgaagaagta
gaagtccctaaagtacaacctcatcaagtaaaggttgcggtcaaattcacgggaatctgt
gggacagacttgcatgaatacttggatggaccaatcttcattccaacagaagagcatgtt
tattctggtcaaaaagcacccgttaccctcggtcacgagtttgctggagaaattgttgag
gttggaagcgatgtgactcgggtcaaagtcggtgatcgtgtgacaattgagccaattttg
gcaaaacacaacttaattggtgattacaaccttgatccaaacttgaacttcgtcggtctt
gcggcagatggtgggtttgctaaatactgtgtcctagatggagatttagtccatgtgatt
ccagatagcttgagctatgagcaagcagcgcttacagaacctgctgctgtggctgtttat
gcagttcgtcaatctgctttgaaaacaggggatacagctgttatctttggtttaggtcca
atcggtctcttgattgtggaagctcttcgtgcggctggtgcttcaaaaatctatgcggtt
gaattgtctccggaacgtcaagccaaagcagaagaactgggtgccattgtagttcgtcca
gaagaaggtgaatcaatcgttgaagccattcatcgcttgacggatggtggagcggatgtg
tcttatgaagtaacaggtgttcctgttgttcttggacaagctcttgcagcagttcataag
gctggtgagtgtatggtcgtatctatttgggaacgcgaagcgagcatcaatccaaatgaa
ttcgccattcaagaaaagacccttaaagggattatcgcttatcgccatatcttccctaaa
gtattggaattgatggaacaaggctacttctctgctgagaaattagttactaagaaaatc
aaattggaaaatattgttcaagatggctttatcgaattaacgcaagataaatcgcaaatc
aagattttggttgagccgtaa

DBGET integrated database retrieval system