KEGG   Streptococcus sp. A12: ATM98_05870Help
Entry
ATM98_05870       CDS       T05522                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA synthase
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
stra  Streptococcus sp. A12
Pathway
stra00280  Valine, leucine and isoleucine degradation
stra00650  Butanoate metabolism
stra00900  Terpenoid backbone biosynthesis
stra01100  Metabolic pathways
stra01110  Biosynthesis of secondary metabolites
stra01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:stra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ATM98_05870
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ATM98_05870
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ATM98_05870
Enzymes [BR:stra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     ATM98_05870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N Chal_sti_synt_N ACP_syn_III ACP_syn_III_C Usp
Motif
Other DBs
NCBI-ProteinID: AMP67290
UniProt: A0A127TTS1
Position
1200735..1201913
Genome map
AA seq 392 aa AA seqDB search
MTIGIDKIGFATSQYVLRLSELAAARNTDPEKLSKGLLLKELSIAPITEDIVTLGASASH
SILTEEEKEEIDMVILATESGIDQSKAAAVFVHGLLGIQPFARSFEMKEACYAATAALDY
AKLHVEKFPQSKVLVIASDIAKYGIDTPGEPTQGAGSVAMLVTQNPRILAFNDDNVAQTR
DVMDFWRPNYSSTPFVNGIYSTQQYLDCLKTTWTEYQKRTGLTLDDFAAVCFHLPYPKLA
LKGLKKILDKSLSPEKQAQLQYNFEQSILYSQKVGNIYTGSLFLGLLSLLENQPQLVAGD
RIALYGYGSGAVAEIFSAHLVEGFEQMLHPNRMAELDQRKALTIDEYEKIFFEEAQLDAE
GNQTFQGYQDQTYALSEINEHQRTYVKVEHHG
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcggtattgataagattggatttgcgaccagccagtatgtcttgcgcttaagt
gagctagcggctgctcgaaatactgatccagaaaaactcagtaaagggctcttattgaaa
gaactaagtattgcccctattacagaggatatcgtcacacttggagcaagtgccagccat
agtattttaaccgaagaagaaaaagaagaaatcgatatggtcatcctggcgaccgagtca
ggaattgatcagagtaaggctgctgctgttttcgttcacggtctcctaggaatccaaccc
tttgctcggagctttgaaatgaaggaagcctgctatgctgccactgccgctttggactat
gctaaacttcatgttgaaaaattcccacagagcaaggtcttggtcattgccagcgatatt
gcaaaatatgggatcgacacccctggagagccgactcaaggagctggatctgtcgctatg
ctggtgacgcagaatccacgtatcctagcctttaatgatgataatgttgctcagacccgt
gacgtcatggatttctggcgtcccaactattccagcacaccctttgtcaatgggatttat
tcgacccaacagtacttggattgcttgaaaacaacttggacagagtatcaaaaacggact
ggcttaaccttggatgattttgcagcggtctgcttccacctgccttatcccaagctcgcc
ctcaagggcttaaaaaagattcttgacaagagtctttctcctgagaaacaagcccaattg
caatacaattttgaacaatccattctctacagccaaaaggttgggaatatctatacgggt
tccctcttcctaggtttgctttctctcttagagaatcagcctcaactagtggctggcgat
cgcattgccctctatggatatggaagtggtgcagtcgctgagatttttagtgctcacttg
gtcgaaggatttgagcaaatgctccatccaaaccgtatggcagaattggatcagcgaaaa
gctcttacgattgacgaatatgagaagatcttcttcgaagaggcacaattagatgctgaa
ggcaatcaaaccttccaaggttaccaagatcaaacctatgccttatcagaaatcaacgaa
caccaacgaacctatgtaaaggtagaacaccatggttaa

DBGET integrated database retrieval system