KEGG   Streptomyces sp. CNQ-509: AA958_04735Help
Entry
AA958_04735       CDS       T03968                                 

Definition
(GenBank) hypothetical protein
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
strc  Streptomyces sp. CNQ-509
Pathway
strc00511  Other glycan degradation
strc00520  Amino sugar and nucleotide sugar metabolism
strc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:strc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AA958_04735
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    AA958_04735
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:strc03110]
    AA958_04735
Enzymes [BR:strc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     AA958_04735
Chaperones and folding catalysts [BR:strc03110]
 Intramolecular chaperones
  Others
   AA958_04735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 F5_F8_type_C Glyco_hydro_20b Glycohydro_20b2
Motif
Other DBs
NCBI-ProteinID: AKH81615
UniProt: A0A0F7MZ95
Position
1176287..1178644
Genome map
AA seq 785 aa AA seqDB search
MSAPSEEQTVRRRTVLAAAGSAALVAASATPALSAPAPAAAPAAADGPAADAAWPDPARD
VARDGTATASSVYDRDPARFAAAHVNDGDLSTRWGSNSPENGYPDPSREWVQIELAEPSP
VHHVVIHWETARAAHYQIHVSDDGETWRTARDVPDAPGGREVLELGLTTAVRYVRMQGVA
VATGWGYSIFAMEVWNGPRPGVGLPAGRVIPVPVAQTSQPDARPFVLDRRSRIVAADPKA
RAVAGLLAGYLRPATGYPLPVVTGPARDGDITLLLGRAHAPSRARLAVAEGYTLAAGERG
VRIAAATPHGLLNGVQTLRQLLPPWIESDTAGPGPWTVEATEIRDHPRFAHRGLMIDPAR
NFLEVREVRELIDGLVQSKGNVLHWHLTDDQGWRVEIDSWPRLTEVGGGMSMPGGRTGFY
TKDQIRDVVRYAAERHVQVIPEIEMPSHTTAARTAYPQLSGAGGYLADLETTYAFVDDVL
REVAALFPSRYVHLGADESDMPHDQYVRFLRRVEGIARGHGKTMIGWSPSCGVGLDTETV
HHYWQDQSREMSREWFDPRRPVLLSPTQQTYLDYPYPTYDTRRAYSWNPSDLTDGWTGAK
VQRDYGLNNEDIIGIEAPIWGERMLRGLPDVQYQVFPRLPAILEKAWSPAEVTEDAEGVV
ARTGVQGARWLFAGRNFWADPGVRWEPAAVGADLRADRDGTVSGAVARLALPGVAPAGVT
ATVEWGDGTTGPATVTGDAPGDRQINGVYRIEAGHRYARRGTYRGTVHLTTPTGRTTARF
TATHG
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcaccgtccgaagagcagaccgtccgccgcagaaccgtcctcgccgccgccggg
tccgccgccctcgtcgcggcctccgccaccccggccctgtccgcaccggcacccgcggcc
gccccggccgccgccgacggacctgccgccgacgccgcctggcccgaccccgcgcgcgac
gtcgccagggacggcaccgcgaccgcgtccagcgtctacgaccgcgacccggcgaggttc
gccgccgcgcacgtcaacgacggcgacctgagcacccggtggggctccaactcgcccgag
aacggctatcccgaccccagccgcgaatgggtgcagatcgaactcgccgagccgagcccg
gtgcaccacgtggtgatccactgggagaccgcgcgcgccgcgcactaccagatccacgtc
tccgacgacggcgagacctggcgtaccgcccgcgacgtccccgacgccccgggcggccgg
gaagtcctcgaactcggcctcaccaccgccgtccgctacgtgcgcatgcagggcgtcgcc
gtggccaccggctggggctactcgatcttcgccatggaggtctggaacggcccgcgcccg
ggcgtcggcctccccgcgggccgggtgatcccggtcccggtcgcgcagacctcgcagccg
gacgcccgccccttcgtgctggaccgccgcagccggatcgtcgccgccgacccgaaggcc
cgggccgtggccgggctcctcgccggctacctgcgcccggcgaccggctacccgctgccc
gtggtcaccggcccggcccgggacggcgacatcacgctgctgctcggccgtgcccacgcc
ccgtcccgggcgcggctggccgtcgccgagggctacaccctggccgccggcgagcgcgga
gtgcggatcgcggcggcgaccccgcacggactgctcaacggcgtgcagacgctccggcaa
ctgctgcccccgtggatcgagagcgacacggcagggcccggcccgtggaccgtcgaggcg
accgagatccgcgaccacccccggttcgcgcaccgcggcctgatgatcgatccggcccgc
aacttcctggaggtccgcgaggtcagggaactcatcgacggactcgtccagtccaagggg
aacgtgctgcactggcacctcaccgacgaccagggctggcgggtcgagatcgactcctgg
ccccggctcaccgaggtcggcggcgggatgtccatgcccggcgggcggaccggcttctac
accaaggaccagatccgggacgtcgtacggtacgccgcggagcggcacgtgcaggtcatc
cccgagatcgagatgccctcgcacacgacggcggccaggaccgcgtacccgcagctgagc
ggcgccggcggctacctggcggatctggagaccacctacgcgttcgtcgacgacgtgctc
cgcgaggtcgccgcgctcttcccctcccggtacgtccacctgggcgccgacgagtcggac
atgccgcacgaccagtacgtacggttcctgcgccgggtcgagggcatcgcccgcggccac
gggaagaccatgatcggctggtcgccgagctgcggggtcggcctggacaccgagacggtc
caccactactggcaggaccagagccgggagatgtcacgggagtggttcgacccgcgccgc
ccggtgctgctctccccgacccagcagacgtacctggactacccctacccgacgtacgac
acccggcgcgcgtactcgtggaacccgtccgacctcaccgacggctggacgggcgccaag
gtgcagcgcgactacgggctcaacaacgaggacatcatcggcatcgaggcgccgatctgg
ggcgagcggatgctgcgcggcctgcccgacgtgcagtaccaggtgttcccgaggctcccg
gcgatcctggagaaggcgtggtcccccgccgaggtcaccgaggacgccgagggcgtggtg
gccaggaccggagtgcagggcgcgcgctggctcttcgccggccggaacttctgggcggac
ccgggggtgcgctgggagcccgcggccgtcggcgccgatctgcgcgccgaccgggacggc
accgtgagcggcgcggtggcgcggctggcgctgccgggggtggcgccggccggggtcacg
gcgacggtcgagtggggcgacggcaccacgggcccggccacggtcacgggcgacgccccg
ggcgaccgccagatcaacggcgtctaccgtatcgaggccggccaccgctatgcccgccgc
ggcacctaccggggcaccgtccacctcaccaccccgaccggcaggacgaccgcccgcttc
accgccacccacggctga

DBGET integrated database retrieval system