KEGG   Streptomyces sp. CNQ-509: AA958_05270Help
Entry
AA958_05270       CDS       T03968                                 

Definition
(GenBank) fuculose phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
strc  Streptomyces sp. CNQ-509
Pathway
strc00051  Fructose and mannose metabolism
strc01100  Metabolic pathways
strc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:strc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    AA958_05270
Enzymes [BR:strc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     AA958_05270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AKH81706
UniProt: A0A0F7N126
Position
complement(1293616..1294248)
Genome map
AA seq 210 aa AA seqDB search
MRHAWRELLATARRMYSEGLVVGTSGNVSARMGDHVLITPTGVPYEELGDDDLVAVDLRG
RQTHGSLKPTSELPMHLAVYENTDASAVVHTHAVHATAVSTLVPELPTVHYATAALGGPV
RVAPYALYGTPELAAGMLTALAGRSACLLQNHGTVAYGAGLAQAYDRTAQLEWMCRVWLA
ARSAPGLSPSLLSAEELGEVAEKLKGYGQG
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcacgcgtggcgtgagctgctggcgacggcccggcggatgtactccgaagggctg
gtcgtcggaacctcgggcaacgtctccgcgcggatgggcgaccatgtgctcatcaccccg
accggcgttccctacgaggagttgggcgacgacgacctcgtcgccgtcgacctgcggggg
cggcagacgcacggctcgctcaagccgacgagcgagctgcccatgcacctggcggtctac
gagaacaccgacgcgagcgccgtcgtgcacacccacgccgtgcacgcgaccgccgtctcc
acgctcgtgccggaactgcccaccgtccactacgccaccgcggccctcggcggcccggtg
cgcgtcgccccgtacgcgctctacgggacgcccgagctggccgcgggcatgctgacggcg
ctcgccggacggtccgcgtgcctgctgcagaaccacggcaccgtcgcgtacggcgccggt
ctcgcgcaggcgtacgacaggaccgcgcagctcgaatggatgtgccgggtgtggctggcc
gcgcgctcggcgccggggctgagcccgtcgctgctgtcggcggaagagctcggggaggtg
gcggagaagctgaagggctacggccaggggtga

DBGET integrated database retrieval system