KEGG   Streptomyces sp. CNQ-509: AA958_05285Help
Entry
AA958_05285       CDS       T03968                                 

Definition
(GenBank) cobalamin biosynthesis protein CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
strc  Streptomyces sp. CNQ-509
Pathway
strc00860  Porphyrin and chlorophyll metabolism
strc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:strc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AA958_05285
Enzymes [BR:strc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     AA958_05285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 GATase SNO Peptidase_S51 DJ-1_PfpI Peptidase_C26 DUF4198
Motif
Other DBs
NCBI-ProteinID: AKH81709
UniProt: A0A0F7N2S5
Position
1295898..1297427
Genome map
AA seq 509 aa AA seqDB search
MTARAGGLLVAGTTSDAGKSVVTAGICRWLARRGVSVAPFKAQNMSLNSYVTREGAEIGR
AQAMQAAAARTEPTALMNPVLLKPGGEAQSQVVVLGRPVAELSAAGYHGERQRALFDTVT
DCLEELRRAYDVVICEGAGSPAEINLRHSDIVNMGLARAARLPVVVVGDIDRGGVFASFF
GTTALLSAADQGLVAGYLVNKFRGDVSLLEPGLSMLRGLTGRQTLGVLPFRHGLGIDEED
GLRLSLRGLIRELPAEPPHGREALRVAVVPVPLMSNFTDVDALAAEPGVAVQFTDRPEEL
AEADLVVLPGTRGTIRALAWLRERGLDAAVARRAAQGRPVLGICGGFQMLAERIGDAAGV
EARPAQSVAGLGLLPVRVEFAARKTLGRPAGTALGEPVAGYEIHHGVADVRGGEPFLAGC
RVGQVWGTHWHGALENDGFRRAFLRQVAADAGRAFVPAPDTSFAALREEQLEKLGDLIEE
HADTKALLRLIEAGAPGDLPFLPPGAPTT
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
gtgacggcgcgtgccggcggcctgctggtcgccggcaccacgtcggacgcgggcaagagc
gtggtcaccgccggcatctgccggtggctggcccggcgcggcgtctccgtcgcgccgttc
aaggcgcagaacatgtcgctcaactcgtacgtgacccgcgagggcgccgagatcgggcgg
gcccaggccatgcaggcggcggccgcccgcaccgagcccaccgcgctgatgaacccggtg
ctgctgaagcccggcggcgaggcgcagagccaggtggtggtgctgggccggccggtggcg
gagctgagcgcggcgggctaccacggggagcggcagcgggcgctgttcgacacggtcacg
gactgcctggaggagctgcggcgcgcgtacgacgtggtgatctgcgagggcgcgggcagc
ccggcggagatcaacctgcgccacagcgacatcgtcaacatggggctggcgcgggcggcg
cggctgcccgtcgtggtcgtcggggacatcgacaggggcggggtcttcgcgtccttcttc
ggcaccaccgcgctgctgagcgcggcggaccagggcctggtcgcgggctatctggtcaac
aagttccgcggtgacgtctccctgctggagccggggttgtcgatgctgcgcgggctgacc
gggcggcagaccctgggggtgctgccgttccggcacgggctgggcatcgacgaggaggac
gggctgcggctgtccctgcgcggcctcatccgcgagctgcccgcggagccgccgcacggg
cgggaggcgctgcgggtcgcggtggtgccggtgccgctgatgtcgaacttcaccgacgtg
gacgcgctggccgcggagccgggcgtcgccgtgcagttcaccgaccggccggaggagctg
gcggaggcggacctggtggtgctgccggggacgcggggcacgatacgggcgctggcgtgg
ctgcgggagcggggcctggacgcggcggtggcgcgccgggcggcgcaggggcggccggtg
ctgggcatctgcggcgggttccagatgctggcggagcggatcggcgacgcggcgggcgtg
gaggcgcggcccgcgcagtcggtggccgggctgggactgctgcccgtacgggtggagttc
gcggcgcgcaagacgctgggccggcccgcgggcacggcgctgggcgagccggtggcgggg
tacgagatccaccacggcgtggcggacgtacggggcggggagccgttcctcgccgggtgc
cgggtgggccaggtgtgggggacgcactggcacggggccctggagaacgacggcttccgg
cgggcgttcctgcggcaggtggcggcggacgcgggccgggcgttcgtaccggcgccggac
acgtccttcgcggcgctgcgggaggagcagttggagaagctgggcgacctgatcgaggag
cacgcggacaccaaggccctgctgcgcctgatcgaggcgggcgcgccgggcgacctgccg
ttcctgccgcccggggcgccgacgacgtag

DBGET integrated database retrieval system