KEGG   Streptomyces sp. CNQ-509: AA958_06540Help
Entry
AA958_06540       CDS       T03968                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
strc  Streptomyces sp. CNQ-509
Pathway
strc00471  D-Glutamine and D-glutamate metabolism
strc00550  Peptidoglycan biosynthesis
strc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:strc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    AA958_06540 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AA958_06540 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:strc01011]
    AA958_06540 (murD)
Enzymes [BR:strc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     AA958_06540 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:strc01011]
 Precursor biosynthesis
  Amino acid ligase
   AA958_06540 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C AlaDh_PNT_C Pyr_redox Pyr_redox_2 NAD_binding_7 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AKH81924
UniProt: A0A0F7N3G4
Position
complement(1575629..1577065)
Genome map
AA seq 478 aa AA seqDB search
MSEFEGRRVTVAGLGVSGGPAARALHRLGAEVTVVDGADHDRARAQAAELEPLGVTVRLG
DGDTLPEGTELVVTTPGWQPSAPLFAAAEAAGVPVWGDVELAWRLRATSPGGRPPAEWLA
ITGTNGKTTAVKMLAAMLAAAGLRTAAVGNIGVPLVDVVTGHGPYADLDVLAVELSSYQL
HWATSVRAHSAAVLNLAPDHLDWHGSMEAYAADKGRIYEGNRVACVYNAADPVTEELVRK
ADVEEGCRAVGFTLGAPAPGQLGVVDGLLVDRAFVPDPQRTAQELAAVADVQPPAPHNVA
NALAAAALARAYGAGPAAVREGLRAFRPEPHRIERVAEIGGVTYVDDSKATNTHATEASL
AAYDGIVWIAGGLAKGATFDDLVAGAAKRLRAAVLLGRDRALIAGALARQAPEVPVVDIA
RTDSGAMAVAVAEAARLAREGDTVLLAPACASMDMFTNYNVRGEVFTAAVHELAADGA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagttcgagggccgccgtgtgaccgtcgcggggctcggggtcagcggcggcccc
gccgcccgcgcgctgcaccggctcggcgcggaggtcaccgtcgtcgacggcgctgaccac
gaccgggcccgggcgcaggccgcggagctggagccgctcggcgtgaccgtccgcctcggc
gacggcgacaccctgcccgagggcacggaactggtcgtcaccacgcccggatggcagccc
tccgccccgctgttcgccgccgccgaggcggccggggtgccggtctggggcgacgtcgag
ctggcctggcggctgcgcgccacctcgcccgggggccggccgcccgccgagtggctggcg
atcaccggcaccaacggcaagaccaccgcggtgaagatgctcgccgccatgctcgccgcc
gccgggctgcgcaccgccgccgtgggcaacatcggcgtcccgctcgtcgacgtcgtcacc
ggccacggcccgtacgcggacctcgacgtgctcgccgtcgagctgtccagctaccagctc
cactgggccacttccgtacgcgcccactccgccgccgtcctcaacctcgcgcccgaccac
ctcgactggcacggctccatggaggcgtacgccgccgacaagggccgcatctacgagggc
aaccgggtggcgtgcgtctacaacgccgccgacccggtcaccgaggaactggtgcgcaag
gccgacgtcgaggagggctgccgcgcggtcgggttcaccctcggcgcgcccgcccccggg
cagctcggagtggtcgacgggctgctggtggaccgggcgttcgtgccggacccgcagcgc
accgcgcaggagctggccgccgtcgccgacgtccagccgcccgccccgcacaacgtcgcc
aacgcccttgccgccgcggccctcgcgcgcgcgtacggcgccgggcccgcggccgtacgc
gaggggctgcgcgccttccgccccgagccgcaccgcatcgaacgcgtcgccgagatcggc
ggcgtgacgtatgtggacgactccaaggccaccaacacccacgccaccgaagcctcgctg
gccgcgtacgacgggatcgtctggatcgccggcggtctcgccaagggcgccaccttcgac
gacctcgtcgctggcgcggcgaagcggctgcgcgcggcggtgctgctgggccgggaccgg
gcgctgatcgccggggcgctggcgcggcaggcgccggaggtgccggtggtggacatcgcg
cggacggactccggcgcgatggcggtggccgtcgccgaggcggcgcggctggcccgcgag
ggcgacaccgtgctgctggcgccggcctgcgcgtcgatggacatgttcacgaactacaac
gtgcgcggcgaggtcttcaccgccgccgtacacgaactcgccgccgacggggcctag

DBGET integrated database retrieval system