KEGG   Streptomyces sp. CNQ-509: AA958_16705Help
Entry
AA958_16705       CDS       T03968                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
strc  Streptomyces sp. CNQ-509
Pathway
strc00450  Selenocompound metabolism
strc00970  Aminoacyl-tRNA biosynthesis
strc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:strc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AA958_16705
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AA958_16705
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:strc01007]
    AA958_16705
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:strc03016]
    AA958_16705
Enzymes [BR:strc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     AA958_16705
Amino acid related enzymes [BR:strc01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   AA958_16705
Transfer RNA biogenesis [BR:strc03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AA958_16705
 Prokaryotic type
   Other AARSs
    AA958_16705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 DALR_2
Motif
Other DBs
NCBI-ProteinID: AKH83579
UniProt: A0A0F7N840
Position
3944198..3945814
Genome map
AA seq 538 aa AA seqDB search
MAATGEEQQGTKAYYVSTPIYYVNDAPHLGHAYTTVAGDVLTRWHRQRGEKVWYLTGTDE
HGQKIMRTAEAHGVTPQEWCDKLVEEAWKPLWEHLEIANDDFIRTTEKRHTDRVQEFVQD
LYDKGEIYQGGYEGPYCVGCEEYKTPGELLDGEGEYAGLKLCPIHKTPVEMLKEENYFFK
LSEYGPKLLEFYEANPGFVQPESARNEVVNFVRQGLNDLSISRSTFDWGVRVPWDDKHVI
YVWIDALLNYATAVGYGADEQKFAGTWPADVHLVGKDILRFHAVIWPAMLMANGLPLPGK
VFANGWLMVGGEKMSKSNLTGIKPQDLTDHFGVDAYRWYFLRAIQYGQDGSFSWEDFTHR
YTSELANDYGNLASRVGAMTVKYFDGDLPAAPAAGPAEQVIVDGLAHAAAEADRRIGDEL
DFAGGIAAVFDFIKKVNLYLTEQEPWKVAKDTSPEAQARLATILYTAAEALRAVAVLLHP
VMPRTSQQLWSSLGAEPALGPLADQRLAEAADWGRLPAGARVTKGAILFPRLEEPKQS
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggcggccactggagaagagcagcaggggacgaaggcgtactacgtctcgacccccatc
tactacgtgaacgacgctccgcacctgggccacgcctatacgaccgtcgcaggcgacgtg
ctcacccgctggcaccgccagcgcggtgagaaggtgtggtacctcaccggcacggacgag
cacggtcagaagatcatgcgcaccgcggaggcgcacggcgtcaccccgcaggagtggtgc
gacaagctcgtggaggaggcgtggaagcccctctgggagcacctggagatcgcgaacgac
gacttcatccgcaccacggagaagcggcacacggaccgggtgcaggagttcgtccaggac
ctgtacgacaagggcgagatctaccagggcggctacgagggcccgtactgcgtcggctgc
gaggagtacaagacccccggcgagctgctcgacggcgagggagagtacgcgggcctgaag
ctctgccccatccacaagacgccggtggagatgctgaaggaggagaactacttcttcaag
ctctcggagtacggtccgaagctgctggagttctacgaggccaaccccggcttcgtccag
cccgagtcggcccgtaacgaggtcgtgaacttcgtccggcagggcctcaacgacctgtcg
atctcccgctccaccttcgactggggcgtgcgggtcccgtgggacgacaagcacgtgatc
tacgtgtggatcgacgccctcctcaactacgcgaccgccgtgggctacggcgcggacgag
cagaagttcgccggcacctggccggcggacgtccacctcgtcggcaaggacatcctccgc
ttccacgcggtgatctggccggcgatgctgatggccaacgggctgccgctgccgggcaag
gtcttcgccaacggctggctgatggtcggcggcgagaagatgtcgaagtccaacctgacc
ggcatcaagccgcaggacctcacggaccacttcggcgtcgacgcgtaccgctggtacttc
ctgcgggccatccagtacggccaggacggctcgttctcctgggaggacttcacccaccgc
tacaccagcgaactggccaacgactacggcaacctggcgtcgcgcgtgggcgcgatgacc
gtcaagtacttcgacggcgacctcccggcggccccggccgcgggccccgcggaacaggtg
atcgtcgacggcctggcgcacgcggcggcggaggcggaccggcggatcggcgacgaactc
gacttcgcgggcggcatcgcggcggtcttcgacttcatcaagaaggtcaacctgtacctg
acggaacaggagccctggaaggtcgcgaaggacacctcccccgaggcccaggcccgcctg
gcgacgatcctctacaccgcggcggaggccctccgcgcggtcgcggtcctgctgcacccg
gtgatgccgcgcacgtcccagcagctctggtcgtccctgggcgcggaacccgccctgggc
ccgctggccgaccagcgcctcgcggaggccgccgactggggccgcctcccggcgggcgcc
cgggtgacgaagggtgcgatcctcttcccgcgcctggaggagccgaagcagtcctga

DBGET integrated database retrieval system