KEGG   Streptomyces sp. CNQ-509: AA958_22385Help
Entry
AA958_22385       CDS       T03968                                 

Definition
(GenBank) GlcNAc-PI de-N-acetylase
  KO
K18455  mycothiol S-conjugate amidase [EC:3.5.1.115]
Organism
strc  Streptomyces sp. CNQ-509
Brite
KEGG Orthology (KO) [BR:strc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AA958_22385
Enzymes [BR:strc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.115  mycothiol S-conjugate amidase
     AA958_22385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIG-L
Motif
Other DBs
NCBI-ProteinID: AKH84491
UniProt: A0A0F7N8W1
Position
5168301..5169173
Genome map
AA seq 290 aa AA seqDB search
MSDDLRLMAVHAHPDDESSKGAATMAKYVSEGVEVLVATCTGGERGSILNPKLQGDAFIE
KNMHEVRRKEMAEAREILGVKQAWLGFVDSGLPEGDPLPPLPEGCFALQDVDEAAEALVR
LIREFKPQVITTYDENGGYPHPDHIMTHKITMAAFEAAGDPARYPDAGEPWQPLKVYYNQ
GFNRPRTVALHEAMLARGLESPYGEWLERWKEFERKERTITTYVPCADFFAIRDKALIAH
ATQIDPDGPFFKIPMEVQQEVWPTEEYELAKSLVDTSLPEDDLFAGIRDN
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgatgacctgcggctgatggccgtccacgcacaccccgacgacgagtcgagcaag
ggtgcggccaccatggccaagtacgtctcggagggcgtcgaggtcctggtcgccacctgc
acgggaggcgagcgggggtcgatcctgaacccgaagcttcagggcgatgccttcatcgag
aagaacatgcacgaggtacggcgcaaggagatggccgaggcgcgggagatcctcggtgtg
aagcaggcgtggctggggttcgtcgactccgggctgccggagggggacccgctgccgccg
cttccggagggctgcttcgcgctgcaggatgtcgacgaggcggcggaggcactcgtccgg
ctgatccgtgagttcaagccgcaggtcatcacgacctacgacgagaacggcggctatccg
caccccgaccacatcatgacccacaagatcacgatggccgccttcgaggccgccggcgac
cccgcgcgctacccggacgcgggcgagccctggcagccgctgaaggtctactacaaccag
ggcttcaaccggccgcggaccgtcgcgctgcacgaggcgatgctcgcgcgcgggctggag
tcgccgtacggggagtggctggagcggtggaaggagttcgagcgcaaggagcgcacgatc
acgacgtacgtgccgtgcgccgacttcttcgcgatccgcgacaaggcgctgatcgcgcac
gcgacgcagatcgaccccgacgggccgttcttcaagatccccatggaggtccagcaggag
gtctggcccaccgaggagtacgagctggcgaagtcgctcgtggatacttccctccccgag
gacgacctcttcgccggcatccgcgacaattga

DBGET integrated database retrieval system