KEGG   Streptomyces sp. CNQ-509: AA958_31860Help
Entry
AA958_31860       CDS       T03968                                 

Definition
(GenBank) GntR family transcriptional regulator
  KO
K16423  (S)-3,5-dihydroxyphenylglycine transaminase [EC:2.6.1.103]
Organism
strc  Streptomyces sp. CNQ-509
Pathway
strc00261  Monobactam biosynthesis
strc01055  Biosynthesis of vancomycin group antibiotics
strc01100  Metabolic pathways
strc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:strc00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01055 Biosynthesis of vancomycin group antibiotics
    AA958_31860
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    AA958_31860
Enzymes [BR:strc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.103  (S)-3,5-dihydroxyphenylglycine transaminase
     AA958_31860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_MocR
Motif
Other DBs
NCBI-ProteinID: AKH86051
UniProt: A0A0F7NCW9
Position
7469004..7470395
Genome map
AA seq 463 aa AA seqDB search
MAAPGPEALVAGAVPNVPVPGAAPSTPAPAARPLRKAELHGSVSDPLLDTMNFLNEITLR
YPDAISFAPGRPYDGFFDTEQVFTHMRTYLDHLAARGGTPEDIRTALYQYGPTAGQIREI
IAESLRADEGIDVPAESVVVTVGAQEAMLLVLRALISGPDDVLMVASPCYVGITGAARLL
DVAVHPVEEREDGFHAADLEAAVLAEKARGRRPRAFYLVPDHSNPSGATLTPRARTDLLD
LAARHDLLILEDSPYRLVSPGPPPPTLKSLDRTQCVVHLGSYSKTVFPGARVGFAVADQT
VADDSGATSLLADELARIKSMVTVNTPSLSQAAVAGALLAAQGLVSELNSRAAAYYGDAM
RTMLRALDERLPAARRNALGVRWNRPEGGFFLTVQVPFPADDAALTRSAQDFGVIWTPMS
HFHPGAGGGHRALRLSTSYLTTEEIDEGAARLARFIEAGTRAA
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggctgctccgggtcccgaagcgctcgtcgccggtgccgtgccgaacgtcccggtgccg
ggcgccgcgccctcgacgcccgccccggccgcgcgcccgctgcgcaaggccgagctgcac
ggcagcgtgtccgaccccctgctggacacgatgaacttcctcaacgagatcacgctccgc
taccccgacgcgatctccttcgcccccggccggccgtacgacgggttcttcgacacggag
caggtcttcacgcacatgcggacctacctcgaccacctggccgcccgcggcggcaccccg
gaggacatccgcaccgccctctatcagtacggcccgaccgccggtcagatccgcgagatc
atcgccgagtcgctccgcgccgacgagggcatcgacgtgccggccgagtccgtcgtcgtg
accgtcggtgcccaggaggccatgctgctggtgctgcgcgcactcatcagcggccccgac
gacgtcctgatggtcgccagcccgtgctacgtcggcatcaccggggcggcccggctgctc
gacgtcgccgtgcaccccgtggaggagcgcgaagacggcttccacgccgccgatctcgag
gcggcggtgctggcggagaaggcgcgcggccgccgcccccgcgccttctacctggtcccc
gaccactccaacccctccggcgccacgctcacgccccgggcccgcacggacctgctggac
ctggccgcccgccacgacctgctcatcctggaggacagcccgtaccggctggtgagcccg
ggacccccgccgcccaccctgaagtcgctcgaccgcacccagtgcgtcgtccacctcggg
tcctactccaagaccgtcttccccggcgcccgcgtcggcttcgccgtcgccgaccagacc
gtcgccgacgactccggagccaccagcctgctcgccgacgagctcgccaggatcaagagc
atggtgacggtgaacaccccgtccctgagccaggcggcggtcgccggcgcgctgctagcc
gcgcaggggctcgtctccgagctgaactcccgtgcggcggcgtactacggagacgccatg
cggaccatgctccgggccctggacgagcggctgcccgccgcccgcaggaacgcgctgggg
gtgcggtggaaccggcccgagggcggcttcttcctcaccgtgcaggtgccgttccccgcc
gacgacgcggcgctcacccgctccgcccaggacttcggcgtcatctggacgccgatgagc
cacttccaccccggcgccggcggcggccaccgcgccctccggctctccaccagctatctg
accaccgaggagatcgacgagggcgccgcacgcctcgcccgcttcatcgaagccgggacg
agggccgcgtga

DBGET integrated database retrieval system