KEGG   Streptomyces sp. CNQ-509: AA958_32210Help
Entry
AA958_32210       CDS       T03968                                 

Definition
(GenBank) dimethylallyltranstransferase
  KO
K13787  geranylgeranyl diphosphate synthase, type I [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
strc  Streptomyces sp. CNQ-509
Pathway
strc00900  Terpenoid backbone biosynthesis
strc01100  Metabolic pathways
strc01110  Biosynthesis of secondary metabolites
strc01130  Biosynthesis of antibiotics
Module
strc_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:strc00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AA958_32210
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:strc01006]
    AA958_32210
Enzymes [BR:strc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     AA958_32210
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     AA958_32210
    2.5.1.29  geranylgeranyl diphosphate synthase
     AA958_32210
Prenyltransferases [BR:strc01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   AA958_32210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: AKH86115
UniProt: A0A0F7NCB1
Position
7581721..7582815
Genome map
AA seq 364 aa AA seqDB search
MPRPEPDTDTAATPGAAEVLALLDHARELTNPVLRTVVDRLVPPMDTVAAYHFGWIDAQG
DPADGDGGKAVRPLLSLLAAEAAGASPETGVPGAVAVELVHNFSLLHDDLMDGDEQRRHR
DTVWKAYGPAQAILVGDALFALACELLLELDTPEAARAARRLNTATRRLIDGQAQDISYE
HRESVSVAECLEMEGNKTGALLACACSIGAVLAGAGDEAADGLERFGLHLGLAFQAVDDV
LGIWGEPAVTGKQTWSDLRQRKKSLPVCAALAAGGPASAELAKTLAADAQRADGRNTDAK
SDFDEEEFAARAALIEEAGGRRWTQEEAQRQHESALASLDGVKMPEDIRERFVALADFVV
VRRH
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
gtgccccgtccagaaccggacaccgacaccgcggccacccccggcgccgccgaagtcctg
gccctgctggaccatgcccgggagctgaccaaccccgtgctgcgtaccgtcgtcgaccgg
ctcgtaccccccatggacaccgtcgccgcctaccacttcggctggatcgacgcgcagggc
gaccccgctgacggagacggcggcaaggccgtacgccccctcctctcgctgctcgccgcc
gaggccgccggcgcctccccggagaccggcgtccccggcgccgtcgccgtggagctggtg
cacaacttctccctcctccacgacgacctcatggacggcgacgagcagcggcgccaccgc
gacacggtgtggaaggcgtacggtcccgcgcaggccatcctcgtcggcgacgccctcttc
gcgctcgcctgcgaactgctgctggaactcgacacgcccgaggcggcacgcgccgcccgc
cggctgaacaccgccacccgcaggctcatcgacggccaggcacaggacatctcgtacgag
caccgcgagagcgtcagcgtcgccgagtgcctggagatggagggcaacaagaccggcgcg
ctgctcgcctgcgcctgctccatcggcgccgtgctcgccggcgccggcgacgaggcggcc
gacggtctggagcgcttcggcctccatctgggcctggccttccaggccgtcgacgacgtg
ctcggcatctggggcgagcccgccgtcaccggcaagcagacctggagcgatctgcgccag
cgcaagaagtccctgccggtgtgcgcggcgctggccgcgggcggccccgcctccgccgag
ctggcgaagacgctcgccgccgacgcccaacgcgccgacggccggaataccgatgcaaaa
agtgacttcgacgaggaagaattcgctgcccgggccgcgttgatcgaagaagccggggga
cgccggtggactcaggaggaggcacagagacagcacgagagcgctctcgcctcgctcgac
ggggtgaagatgccagaggacatccgcgaacggttcgtcgcactcgccgacttcgtcgtc
gtacgccggcactga

DBGET integrated database retrieval system