KEGG   Streptomyces sp. CNQ-509: AA958_32220Help
Entry
AA958_32220       CDS       T03968                                 

Definition
(GenBank) 1-hydroxy-2-methyl-2-butenyl 4-diphosphate reductase
Organism
strc  Streptomyces sp. CNQ-509
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PNP_UDP_1
Motif
Other DBs
NCBI-ProteinID: AKH86117
UniProt: A0A0F7NHB3
Position
7584898..7585560
Genome map
AA seq 220 aa AA seqDB search
MPDAPAPLLAVCALGIERRALASGTGRPEGAAGGAGPVHVLRTGMGPERAVRAVARRLAE
EPYREAPVIAAGFCAGLLPDMRPGDVVVADAVRDGEGTETTGCPDNGPLFDALALLDARV
HTGLLLGTDHVVRGAAGRAALRERGAVAADMESAATLRTAAATSGTRPVAAVRVVVDAPE
HELVRFGTLRGGITAYRVLSSVLPAFFEWHRHVTIPRRRT
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacgcacccgcgccgctgctcgccgtctgcgccctcggcatcgagcgccgggcg
ctggcgtcgggcaccggccgccccgagggcgcggccggcggtgcgggtcctgtccacgtg
ctgcgcaccggcatgggtcccgagcgggccgtgcgggccgtggcccgccggctcgcggag
gagccgtaccgggaggcgccggtgatcgccgccggcttctgcgccgggctgctgcccgac
atgcgccccggcgacgtcgtcgtcgccgacgccgtacgggacggcgagggcaccgagacc
accggctgcccggacaacgggccgctgttcgacgccctcgcgctcctcgacgcccgggtg
cacaccgggctgctgctcggcaccgaccacgtcgtacgcggcgcggccggccgcgcggcg
ctgcgcgagcgcggcgcggtcgccgcggacatggagtcggccgccacgctgcgcacggcc
gcggcaacctccgggacccggccggtggccgccgtacgggtggtcgtggacgcgcccgag
catgaactcgtccgtttcggaacgctgcgcggtggcatcaccgcgtaccgcgtgctcagc
tcagttcttcctgcatttttcgaatggcaccgtcatgtgacgatccccaggaggcgaacc
tga

DBGET integrated database retrieval system