KEGG   Streptomyces sp. CNQ-509: AA958_32245Help
Entry
AA958_32245       CDS       T03968                                 

Definition
(GenBank) protein tyrosine phosphatase
  KO
K01104  protein-tyrosine phosphatase [EC:3.1.3.48]
Organism
strc  Streptomyces sp. CNQ-509
Pathway
strc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:strc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AA958_32245
Enzymes [BR:strc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     AA958_32245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Y_phosphatase3 Y_phosphatase PKS_DE Y_phosphatase2 DSPc
Motif
Other DBs
NCBI-ProteinID: AKH86121
UniProt: A0A0F7ND22
Position
complement(7590029..7590820)
Genome map
AA seq 263 aa AA seqDB search
MTQTTEPELTGVRNFRDVGGLPTTGGGRTRTGRLYRSGHLAHATAEDTAFLGSLGLRTVY
DFRNAADIRLDGPDVDLPGVRNVNVPLNDPAEGKEFWKLVRDGDIPTLRSLLGDGQAAAR
MEDSYRDMILHRNAEHSRVLHSLADDGAPALLHCAAGKDRAGLTIALALLAVGVEREAIE
ADYLESNAQHRRYRVQRGEGAQGGTSPEVMELLSPLFDARASYLGAAFATIAERWGTVDR
YFHEALRLSHTTRDRLRASLLTG
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagacgaccgagccggagctgaccggtgtccgcaacttccgcgacgtcggcggg
ctgcccaccaccggcggcggccggaccaggaccggccggctctaccgcagcggccacctg
gcccacgccaccgccgaggacaccgccttcctcggctcgctcggtctgcgcacggtctac
gacttccgcaacgccgccgacatccgcctcgacggccccgacgtcgaccttccgggcgta
cggaacgtcaacgtgccgctcaacgacccggcggagggcaaggagttctggaagctggtc
cgcgacggcgacataccgacgctgcgctcgctgctcggcgacggccaggcggcggcgcgc
atggaggactcgtaccgggacatgatcctccaccgcaacgcggagcactcccgggtcctg
cactcgctggccgacgacggcgcccccgcgctgctgcactgcgcggcgggcaaggaccgg
gccgggctgaccatcgcgctcgcgctgctggccgtgggcgtcgagcgggaggcgatcgag
gcggactacctggagtccaacgcgcagcaccgccgctaccgggtccagcgcggcgagggc
gcgcagggcggcacctcgccggaggtgatggagctgctcagcccgctgttcgacgcccgg
gcgagctacctgggcgcggccttcgccaccatcgccgagcgctggggcaccgtcgaccgc
tacttccacgaggcccttcgcctcagccacaccacccgcgaccgcctgcgcgccagcctg
ctgaccggctga

DBGET integrated database retrieval system