KEGG   Streptomyces sp. CNQ-509: AA958_32485Help
Entry
AA958_32485       CDS       T03968                                 

Definition
(GenBank) amidohydrolase
  KO
K07045  uncharacterized protein
Organism
strc  Streptomyces sp. CNQ-509
Brite
KEGG Orthology (KO) [BR:strc00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    AA958_32485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_2 TAT_signal
Motif
Other DBs
NCBI-ProteinID: AKH87196
UniProt: A0A0F7NFW4
Position
complement(7640496..7641623)
Genome map
AA seq 375 aa AA seqDB search
MGRRGFLAASTALGAGAGLSAYAAVSAADGNKTADKTADIALRDRDLPFIGTEETFSTPT
LLKLNSINQDHIAFLEEIGLSDLGQRRIGDMDAGGLNVQILSAHTPSVQNVPGQRGIDLA
YRLNRQLVDGPIAKYPGRFKAFATLPLQSPEAAADELERSVREDGFLGALTNGHIAKKYL
DHPDFEPVLARAVALDVPIYLHPGYPADEVFKIYYSTTRSEYTEDYQDYILSGSGYGWHQ
EVLTQCIRMITYGVFDRFPKLKIIIGHMGEGLPFYYERIVNDMGEPTEDSLEKPIGQYFQ
DNFWVTTSAFPQTELLHLLLKYISVDRVMFATDYPFADIKEQTDWFRGVDLPREDKEKIA
FRNAEKLFGMKVPVK
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgggacgtcgcggctttctagccgcttccacggcacttggcgctggtgccggcttgtcc
gcgtatgccgccgtttcggcagcggacgggaacaagactgcggacaagactgcggacatt
gcattgcgagaccgggacctgcccttcatcggcacggaggagaccttttcgactcccacg
ttgttgaagctgaactccatcaatcaggatcacatagcgttccttgaggaaattggcctt
tcggatctaggtcaacgccgcatcggcgatatggatgcggggggactcaacgttcaaatc
ctctctgctcatacaccctccgtgcaaaatgtccctgggcaaaggggcatcgaccttgcc
tatcgtcttaaccggcaacttgtagacgggccaatcgctaaatatccgggccgcttcaag
gctttcgccaccttgcccttgcagagcccggaggcggcggcggacgaactggaacgctcg
gttcgggaagatggcttcttgggcgcactgaccaacggacacatcgcgaagaagtatctc
gatcatcccgatttcgagcctgtgctggcacgtgccgttgctctcgatgtgccgatctac
ctgcatcccggctatccagctgacgaggtcttcaagatctactacagcaccacacggtct
gaatacacggaagactaccaagactacattctcagtgggtctggatatggctggcaccag
gaggtgctgacccaatgcattcggatgatcacgtacggggtcttcgacagattccccaaa
ctgaaaatcatcatcggccacatgggcgaaggtcttcccttctactacgagcggatcgtc
aatgacatgggcgagccaacagaagactcgctcgagaagcccatcgggcaatacttccag
gacaacttctgggtcacaaccagcgcattcccccagaccgaactgctccatctcctgctg
aagtacataagcgtggatcgagtgatgttcgcaaccgactacccgttcgcggacataaag
gagcagaccgactggttccgcggagtcgatttgccacgcgaagacaaggaaaagattgcg
ttccgaaatgcagagaaactgttcggaatgaaagtgcccgtgaagtga

DBGET integrated database retrieval system