KEGG   Streptomyces sp. CNQ-509: AA958_32495Help
Entry
AA958_32495       CDS       T03968                                 

Definition
(GenBank) hypothetical protein
Organism
strc  Streptomyces sp. CNQ-509
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AKH86157
UniProt: A0A0F7NHE3
Position
7643021..7643440
Genome map
AA seq 139 aa AA seqDB search
MFSDLLDDAHRYVADLLAGMDARYDLGDGHRFVGTLCPDMKLTLERPDPDVLTAVNRSAD
LLREGRGPLLDLVDRAEARDAAAAWSGRGSTVTARTGRVDVDALPIRPDGCVARALPTGQ
DLDTTTLVRALGTWFGQPA
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgttctccgacctgctcgacgacgcccaccggtacgtcgccgacctgctcgccggcatg
gacgcccggtacgacctgggtgacggtcaccggttcgtcggcaccctgtgcccggacatg
aagttgacgctggagcggcccgacccggacgtcctcaccgcggtgaaccggtcggcggac
ctgctgcgtgaggggcgggggcccctgctcgacctcgtcgaccgcgcggaggcccgagac
gccgcggccgcgtggagcggacggggcagcaccgtcaccgcccgcacgggccgggtggac
gtcgacgcgttgcccatccggcccgacggctgtgtcgcccgggccttgcccaccgggcag
gacctcgacaccaccacgctggtgcgtgcgctgggcacatggttcggccaaccggcctga

DBGET integrated database retrieval system