KEGG   Streptomyces sp. CNQ-509: AA958_32575Help
Entry
AA958_32575       CDS       T03968                                 

Definition
(GenBank) aminotransferase
Organism
strc  Streptomyces sp. CNQ-509
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_4
Motif
Other DBs
NCBI-ProteinID: AKH86172
UniProt: A0A0F7NHF4
Position
complement(7664867..7665646)
Genome map
AA seq 259 aa AA seqDB search
MEASRASETEARQLTTLAMTNYGHFTTMRVESGRVRGLSLHLERLRRDCRAVFGTGLETD
RVRAAVRDALVDAPDPVTVRVTVLDPGLRLERPGAEAHPQFLVTCRPAAVEPPPLRVGTR
PHCREVPTVKHTGLFGALHERRLSQCAGFDDALFLEGRSAVSEGPTWNVGFFDGAGLVWP
TANVLPGVTMALLRRHHTGAQRAEVIDTARLGGMEAAFATNAAVGVRPIASIDGVAYDPE
HPVLHTLRKEYDSVIPEPL
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggaagcgagtagggcctcggaaaccgaggcacgccagctcacgacgctggctatgacc
aactacggtcacttcaccaccatgcgcgtggagagcggacgggtgcgcgggctctccctc
cacctggagcgcctgcggcgtgattgccgcgccgtcttcggcacggggctggagacggac
cgtgtacgggccgccgtccgggacgccctcgtcgacgccccggacccggtcaccgtgcgg
gtgaccgtgctcgaccccgggctgcggctggagcgaccgggagccgaggcacacccgcag
ttcctggtgacatgccggccggctgccgtggagccgccgcccctgcgcgtgggcaccagg
ccgcactgccgggaggtgccgacggtcaaacacaccggcctgttcggcgcgctgcacgag
cggcggctctcccagtgcgccggattcgacgacgccctgttcctcgaaggccggtccgcc
gtgtcggagggcccgacgtggaacgtcggcttcttcgacggcgccggcctcgtgtggccg
accgcaaacgtcctccccggcgtcaccatggccctgctgcggcggcaccacaccggcgcg
cagcgcgcggaggtgatcgacaccgcacgcctcggcgggatggaggcggccttcgccacc
aacgccgcggtcggcgtccgccccatcgcctcgatcgacggggtcgcgtacgacccggaa
caccccgtcctgcacacgctgcgcaaggagtacgattccgtcatccctgagcccctgtga

DBGET integrated database retrieval system