KEGG   Streptomyces sp. CNQ-509: AA958_32585Help
Entry
AA958_32585       CDS       T03968                                 

Definition
(GenBank) hypothetical protein
Organism
strc  Streptomyces sp. CNQ-509
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HpaB
Motif
Other DBs
NCBI-ProteinID: AKH86174
UniProt: A0A0F7NFD1
Position
complement(7666825..7667019)
Genome map
AA seq 64 aa AA seqDB search
MCFCLSQMTAQRSTVWACSTGASASETISPGRMKLSSVATPAAAWTARSFYSKDRTMRAR
AARL
NT seq 195 nt NT seq  +upstreamnt  +downstreamnt
gtgtgcttctgcctctcccagatgacggcccagcgcagcacggtctgggcctgctcgacc
ggggcgagcgcctcggagaccatctcgccggggcggatgaagctgtcgtcggtggcgacg
ccggcggcggcctggaccgcgaggtccttctactcgaaggacaggacgatgcgggcgagg
gcggcgcggctgtag

DBGET integrated database retrieval system