KEGG   Streptomyces sp. CNQ-509: AA958_32725Help
Entry
AA958_32725       CDS       T03968                                 

Definition
(GenBank) hypothetical protein
Organism
strc  Streptomyces sp. CNQ-509
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AKH86196
UniProt: A0A0F7ND83
Position
complement(7693334..7693525)
Genome map
AA seq 63 aa AA seqDB search
MSLRHTAGRNLTVAALLVAAAGFAVQMAAGVTDTPAIPPGLVAIPAAAAVVALPPGRGRA
TGR
NT seq 192 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgcgacacaccgccggccgcaacctgacggtcgccgctcttctggtcgccgcc
gccggcttcgcggtccagatggcggccggagtgacggacaccccggccatcccgcccggg
ctcgtcgccatcccggccgcagcggcggtggtcgcgctcccgcccggccgcggccgggcg
acgggccgctga

DBGET integrated database retrieval system