KEGG   Streptomyces sp. CNQ-509: AA958_32740Help
Entry
AA958_32740       CDS       T03968                                 

Definition
(GenBank) di-trans,poly-cis-decaprenylcistransferase
  KO
K00806  undecaprenyl diphosphate synthase [EC:2.5.1.31]
Organism
strc  Streptomyces sp. CNQ-509
Pathway
strc00550  Peptidoglycan biosynthesis
strc00900  Terpenoid backbone biosynthesis
strc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:strc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AA958_32740
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AA958_32740
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:strc01006]
    AA958_32740
Enzymes [BR:strc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.31  ditrans,polycis-undecaprenyl-diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific]
     AA958_32740
Prenyltransferases [BR:strc01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   AA958_32740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Prenyltransf
Motif
Other DBs
NCBI-ProteinID: AKH87201
UniProt: A0A0F7NFW6
Position
complement(7695553..7696272)
Genome map
AA seq 239 aa AA seqDB search
MRAGPRHVACVMDGNGRWAQQRSLPRTAGHRAAEAAVIDVIEAARTAGVEWLSLYAFSTE
NWIRPGTEVEFLMRLVRRVVRTHAPLLLARGIRCRFLGVADPRIPRALARDFYDLAELTA
GNRGMTLTVAFDHGGRRDIVEAARSLIRSGTPADEVTERLFADHLPFPDTPNVDLVIRTS
GEQRISNFMLWQVAYAEWVFPQVLWPDFRAPDFLAHLHAYRRRDRRFGGVPARTNGDRS
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgcgggaccgcggcacgtggcgtgcgtgatggacggcaacggccggtgggcacag
cagcgttcgcttccccgtacggcgggtcaccgggccgcggaggccgcggtcatcgacgtc
atcgaggcggccaggaccgccggcgtggagtggctcagcctgtacgccttctccaccgag
aactggatccgccccggcactgaggtcgagttcctgatgcggctggtgcgcagggtcgtg
cgcacgcatgcgccgctgctgctcgcgcgcggcatccgctgccgtttcctcggggtcgcc
gacccgcgcatcccccgtgcactggcccgggacttctacgatctggcggagctcaccgcc
ggcaaccgggggatgacgctcaccgtcgccttcgaccacggcgggcgccgggacatcgtc
gaggccgccaggtcgctgatccgtagcgggacgcccgccgacgaggtgactgagcggctc
ttcgcggaccacctgcccttccccgacacccccaacgtggatctggtcatccgcacctcg
ggtgagcagcgcatctccaacttcatgctctggcaggtcgcctacgccgagtgggtcttc
ccccaggtgctgtggccggacttccgggctcccgacttcctcgcccacctgcacgcctac
cggcgccgcgaccgccgcttcggcggcgtacccgcccggacgaacggagaccggtcatga

DBGET integrated database retrieval system