KEGG   Streptomyces sp. CNQ-509: AA958_34045Help
Entry
AA958_34045       CDS       T03968                                 

Definition
(GenBank) HAD family hydrolase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
strc  Streptomyces sp. CNQ-509
Pathway
strc00361  Chlorocyclohexane and chlorobenzene degradation
strc00625  Chloroalkane and chloroalkene degradation
strc01100  Metabolic pathways
strc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:strc00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AA958_34045
   00361 Chlorocyclohexane and chlorobenzene degradation
    AA958_34045
Enzymes [BR:strc01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     AA958_34045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD
Motif
Other DBs
NCBI-ProteinID: AKH86423
UniProt: A0A0F7NGK3
Position
complement(7993811..7994488)
Genome map
AA seq 225 aa AA seqDB search
MSEKRWVTFDCFGTLVDWRHGIATGIDMVAPGRGWELLDVYNRHEPAVQTEHPGMRYSEV
LAEALQRTADEVGIELVEDDARVLTTGIPFWPVFPETRQALRELQEAGWNLALLTNCDRV
IIGETQRRLQIQFDAIVTAEDSGAYKPTHNHFQHFEQSLGVTRDRWVHVAQSYFHDMVPA
SQLDISRVWINRLDEKNDPSIAHAVRRDLTDLTATVNEVHQYVNG
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaagcgttgggtcaccttcgactgtttcggcaccctcgtggactggcgtcac
ggcatcgccaccggcatcgacatggtcgcgcccggtaggggctgggagctgctggacgtc
tacaaccgtcatgagccggcggtgcagacggagcaccccggcatgcgctacagcgaggtc
ctcgcggaggcgctgcagcggacggcggacgaagtggggatcgagctggtggaggacgac
gcccgcgtgctgacgaccggcatcccgttctggccggtcttccccgagacccgccaggcc
ctgcgcgagctccaggaggccggctggaacctcgccctgctcactaactgcgaccgcgtc
atcatcggcgagacccagcgccgcctgcagatccagttcgacgcgatcgtcaccgccgag
gactccggcgcctacaaaccgacccacaaccacttccagcacttcgagcagtccctcgga
gtcacccgtgaccgctgggtgcatgtggcgcagagctacttccacgacatggtgccggcc
agccagctcgacatctcccgggtgtggatcaaccgtctcgacgagaagaacgacccgtcg
atcgcgcacgccgtccgtcgcgacctgaccgatctgacggccaccgtcaacgaggtccac
cagtatgtcaacggctga

DBGET integrated database retrieval system