KEGG   Streptomyces sp. CCM_MD2014: NI25_10855Help
Entry
NI25_10855        CDS       T04862                                 

Definition
(GenBank) sugar hydrolase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
strd  Streptomyces sp. CCM_MD2014
Pathway
strd00460  Cyanoamino acid metabolism
strd00500  Starch and sucrose metabolism
strd01100  Metabolic pathways
strd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:strd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NI25_10855
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    NI25_10855
Enzymes [BR:strd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     NI25_10855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3_C Glyco_hydro_3 Fn3-like CBM_6 Fascin
Motif
Other DBs
NCBI-ProteinID: AIV33929
UniProt: A0A0N6ZGX2
Position
2552558..2555410
Genome map
AA seq 950 aa AA seqDB search
MTAPTPPFRDPRLPFAKRVDDLMSRLTLDEKTAFLHQFAPAVERLGIAAFRTGQEALHGV
AWMGPATVFPQAVGLGATWNEDLVRRVGEAVSKEARAMRARDERVGLNVWSPTVNLLRHP
LWGRNEEGYSEDPKLTSAIATAYTRGLRGDDPVYWRTAPVLKHWLAHNNETARDTSSSSV
RPRVLHEYDLRAFRETVEAGAVAGVMPAYNLVNGRPNHLSPHLGRHLRTWTEEDLLVCSD
AGAPSNLVDSEHYFDTHEEATAAALRAGVDSFTDHGTDSSKIVARVRGALERGLLTEADV
DAAVRRQLSVRFRLGEFDPEHDPYAQVRDFDTPEHRALAREAAEQAIVLLKNDGVLPLAP
GTRVAVVGLLADECKLDWYSGTLIHRSTPLEGLYERFGADRVSFAEGVDRVRLRTADGTF
LHVLPSDDAPDGAHGTEGALDPALLAGRTDLPPLTTDATGTELAMIDWGEGVLTLRAPDG
RYLSVAEDGYVRASADQPGGWIVQETFRLEPHADGHLLRHTGTGRPVQVAADGVKVAADT
GETTAVPDAAVFEVVVAERGEDAVTRVASAADVVVVVAGNDPHINGRETEDRTTLRLPGQ
QERLLRAARAANPATVLALVSAYPYAVDADSLPAVLWTAHGGQAAGTALARVLAGDVSPA
GRLPQTWYADDADLAGLLDYDVIGGRQTYLYFEGTPLFPFGHGLSYASFGYADLAAEAGD
GTVSVSFTVTNTGETAADEVAQLYVRAEAPSVPRPRRELLAHRRFTLAPGASTRVAFEVP
LSALAFWDVAHGRWRLEPGPYALLVGASSEDVRLSTTVTVDGEPAAPRPVGERGLEAADF
DEQSGTEIVDRTKAAGDAVMPTAGGTGELLYRSCDFGAGVTRTTLSVAGTGTVEMSLDGG
PWTAAPSPAAPTAGPYDYTELDGAFTAGGVHDLRIRLRGSLRLAHVGFSG
NT seq 2853 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcacccacgccgccgttccgtgatccgcgactgccgttcgcgaagcgcgtcgac
gacctgatgtcgcggctcacgctcgacgagaagaccgccttcctgcaccagttcgcgccc
gcggtcgagcgtctgggcatcgccgccttccgcaccggccaggaagcactgcacggcgtg
gcctggatgggcccggcgaccgtgttcccgcaggccgtggggctcggcgccacctggaac
gaggatctcgtgcgccgggtcggcgaggcggtgtccaaggaggcccgggcgatgcgcgcg
cgggacgagcgcgtcggcctcaacgtctggtccccgacggtgaacctgctgcgccacccc
ctgtggggccgcaacgaggagggctactccgaggacccgaagctgacctccgccatcgcc
accgcctacacccgggggctgcgcggcgacgacccggtgtactggcgcaccgcgcccgtc
ctcaagcactggctcgcgcacaacaacgagacggcgcgggacacttcctcctcctccgtc
cgcccgcgcgtactccacgagtacgacctgcgggccttccgcgagacggtcgaggcgggc
gcggtggccggggtgatgccggcctacaacctggtcaacgggcgccccaaccacctctcc
ccccacctcggccggcacctgcgcacctggacggaggaagacctgctggtctgctcggac
gcgggcgcgccctccaacctggtcgactcggagcactacttcgacacccacgaggaggcc
accgccgccgcgctgcgggccggtgtggacagcttcaccgaccacggaacggactcctcg
aagatcgtcgcgcgggtgcggggcgccctggaacggggtctgctgacggaggcggacgtg
gacgcggcggtgcggcggcagttgtcggtccgcttccggctcggcgagttcgacccggag
cacgacccgtacgcgcaggtgcgcgacttcgacacgccggagcaccgggcgctcgcccgg
gaggcggccgagcaggcgatcgtcctgctcaagaacgacggcgtcctgccgctggccccc
ggcacccgcgtcgccgtcgtcggactgctcgccgacgagtgcaagctcgactggtacagc
ggcacgctcatccaccgctcgaccccgctggaaggcctgtacgagcggttcggcgccgat
cgcgtgagcttcgccgagggcgtggaccgggtcaggctgcgcacggccgacggcacgttc
ctgcacgtcctgccctcggacgacgcacccgacggggcgcacggcacggagggcgccctc
gacccggcgctgctcgccggccgcaccgacctgccgcccctgaccaccgacgccaccggc
accgagctggcgatgatcgactggggcgagggcgtgctcacgctgcgcgcgcccgacggc
cgctatctctcggtcgccgaggacggctacgtgcgcgcctccgccgaccagcccggcggc
tggatcgtgcaggagacgttccggctcgaaccgcacgctgacggtcacctcctgaggcac
acgggaacgggtcgtccggtccaggtcgccgccgacggcgtgaaggttgccgcggacacc
ggagagaccaccgccgtcccggacgccgcggtcttcgaggtggtcgtcgccgagcgcggc
gaggacgcggtgacgcgggtggcgtcggcggcggacgtggtcgtcgtggtcgcgggcaac
gacccgcacatcaacggccgcgagaccgaggaccgtacgacgctgcgcctgcccggccag
caggaacggctgctgcgcgcggcccgcgccgccaacccggcgaccgtgctcgcgctggtg
tccgcctacccgtacgcggtcgacgccgactccctcccggcggtgctgtggaccgcgcac
gggggccaggcggccggcaccgcactggcccgggtcctcgcgggggacgtctccccggcg
ggccggctcccgcagacctggtacgccgacgacgccgacctcgccggcctcctcgactac
gacgtgatcggcggccgccagacctacctgtacttcgaggggacgccgctgttccccttc
gggcacggcctgtcctacgcgtccttcggttacgcggacctggcggcggaggccggagac
gggacggtgtccgtgtccttcacggtcaccaacaccggtgagacggccgcggacgaggtg
gcccagctctacgtccgtgccgaggccccgtcggttccgcgtccgcgccgcgagctgctt
gcccaccgccggttcaccctcgccccgggcgcctcgacgcgggtcgccttcgaggtcccg
ctgtccgccctcgcgttctgggacgtcgcgcacggccggtggcggctggaaccgggcccg
tacgccctgctggtgggcgcctccagcgaggacgtgcggctgtcgacgaccgtcaccgtc
gacggcgagccggccgcaccgcgcccggtcggcgaacgcggcctggaggcggccgacttc
gacgagcagagcggcacggagatcgtcgaccggacgaaggcggcgggtgacgcggtgatg
ccgacggccggagggacgggcgaactgctctaccgctcctgcgacttcggcgccggtgtg
acgcggacgaccctgtcggtcgcgggcaccggcaccgtcgagatgtccctcgacggaggg
ccgtggacggcggcaccctcgccggccgcgccgaccgcggggccgtacgactacacggag
ctggacggcgccttcaccgccgggggcgtccacgacctccgcatcagactgcgcggctca
ctgcggctcgcgcacgtcggcttctccggttga

DBGET integrated database retrieval system