KEGG   Streptomyces sp. CCM_MD2014: NI25_16670Help
Entry
NI25_16670        CDS       T04862                                 

Definition
(GenBank) arginine--tRNA ligase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
strd  Streptomyces sp. CCM_MD2014
Pathway
strd00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:strd00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    NI25_16670
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:strd01007]
    NI25_16670
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:strd03016]
    NI25_16670
   03029 Mitochondrial biogenesis [BR:strd03029]
    NI25_16670
Enzymes [BR:strd01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     NI25_16670
Amino acid related enzymes [BR:strd01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   NI25_16670
Transfer RNA biogenesis [BR:strd03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    NI25_16670
 Prokaryotic Type
   Other AARSs
    NI25_16670
Mitochondrial biogenesis [BR:strd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    NI25_16670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1d DALR_1 Arg_tRNA_synt_N
Motif
Other DBs
NCBI-ProteinID: AIV34940
UniProt: A0A0N6ZMI2
Position
3828864..3830624
Genome map
AA seq 586 aa AA seqDB search
MASVTSLTDSVQQQLASALTATRPEAAGADPLLRRSDRADYQANGILALAKKAKANPREL
ATEVVAHITTGDELIKDVEVSGPGFLNITVADRAITENLAARLADGERLGVPPKADAGVT
VVDYAQPNVAKEMHVGHLRSAVIGDALRAMLDFTGEKTIGRHHIGDWGTQFGMLIQYLFE
HPGELAPAGDVDGEQAMSNLNRVYKASRAVFDADEEFKERARKRVVALQSGDKETLELWQ
QFVDESKVYFYSVFDKLDMEIRDEEIVGESAYNEGMPETARLLEEMGVAVRSEGALVVFF
DEIRGKDDQPVPLIVQKADGGFGYAASDLTAIRNRVTDLHASTLLYVVDVRQSLHFKMVF
EAARRAGWLNDDVTAHNMAYGTVLGADGKPFKTRAGETVRLEDLLDEAVQRAAEVVREKA
RDLTEEEIRERAAQVGIGAVKYADLSTSPSRDYKFDLDQMVSLNGDTSVYLQYAYARIRS
ILRKAGEVRPAAHPELELHEAERALGLHLDAFGDTVFEAAAEYAPHKLAAYLYQLASLYT
TFYDKCPVLKAETPAQVENRLFLCDLTARTLHRGMSLLGIRTPERL
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atggcctcggtcacgtccctcaccgactccgtccagcagcagctcgcgtccgccctcacg
gccacccggccggaggccgccggcgcagacccgctgctgcgacgcagtgaccgggcggac
taccaggccaacggcatcctcgcgctggccaagaaggcgaaggccaacccgcgggagctg
gcgaccgaggtcgtcgcccacatcaccaccggcgacgagctgatcaaggacgtcgaggtc
tcgggccccggcttcctcaacatcacggtcgccgaccgggcgatcaccgagaacctcgcc
gcgcgcctcgcggacggcgagcgcctcggcgtgcccccgaaggcggacgcgggcgtcacg
gtcgtcgactacgcccagccgaacgtggcgaaggagatgcacgtcggccacctgcgctcg
gcggtgatcggcgacgccctgcgcgccatgctcgacttcaccggcgagaagacgatcggc
cggcaccacatcggcgactggggcacccagttcggcatgctcatccagtacctgttcgag
caccccggcgagctggccccggccggcgacgtcgacggcgagcaggccatgtcgaacctg
aaccgggtgtacaaggcctcgcgcgcggtcttcgacgcggacgaggagttcaaggagcgg
gcccgcaagcgggtcgtcgccctgcagtccggcgacaaggagacgctggagctgtggcag
cagttcgtggacgagtcgaaggtctacttctactccgtcttcgacaagctcgacatggag
atccgcgacgaggagatcgtcggcgagtccgcgtacaacgagggcatgccggagaccgcc
cgcctcctggaggagatgggcgtcgcggtgcgctccgagggcgcgctcgtggtgttcttc
gacgagatccgcggcaaggacgaccagccggtcccgctgatcgtgcagaaggccgacggc
ggcttcggctacgcggcctccgacctgacggcgatccgcaaccgggtcaccgacctgcac
gccagcacgctgctgtacgtcgtggacgtgcgccagtcgctgcacttcaagatggtcttc
gaggcggcccgccgggccggctggctgaacgacgacgtcaccgcgcacaacatggcctac
ggcacggtgctcggcgccgacggcaagcccttcaagacgcgtgcgggcgaaaccgtgcgc
ctggaggacctgctggacgaggccgtgcagcgggccgccgaggtcgtgcgggagaaggcg
cgggacctcaccgaggaggagatccgggagcgggccgcgcaggtcggcatcggcgccgtg
aagtacgcggacctgtcgacctcgcccagccgcgactacaagttcgacctggaccagatg
gtctcgctcaacggcgacaccagcgtctacctccagtacgcctacgcccggatccggtcc
atcctccgcaaggccggcgaggtccgccccgccgcccacccggagctggagctgcacgag
gcggagcgcgcgctgggcctgcacctggacgcgttcggggacacggtcttcgaggcggcc
gcggagtacgccccgcacaagctggcggcgtacctgtaccagctggcgtcgctgtacacg
acgttctacgacaagtgcccggtcctgaaggccgagactccggcgcaggtcgagaaccgc
ctgttcctgtgcgacctcacggcccgcaccctgcaccggggcatgtccctgctgggcatc
cggacgcccgagcggctctga

DBGET integrated database retrieval system