KEGG   Streptomyces sp. CCM_MD2014: NI25_18600Help
Entry
NI25_18600        CDS       T04862                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
strd  Streptomyces sp. CCM_MD2014
Pathway
strd00450  Selenocompound metabolism
strd00970  Aminoacyl-tRNA biosynthesis
strd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:strd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    NI25_18600
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    NI25_18600
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:strd01007]
    NI25_18600
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:strd03016]
    NI25_18600
Enzymes [BR:strd01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     NI25_18600
Amino acid related enzymes [BR:strd01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   NI25_18600
Transfer RNA biogenesis [BR:strd03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    NI25_18600
 Prokaryotic type
   Other AARSs
    NI25_18600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 DUF1659
Motif
Other DBs
NCBI-ProteinID: AIV35265
UniProt: A0A0N6W5H7
Position
4252627..4254243
Genome map
AA seq 538 aa AA seqDB search
MAATGSEKQGAKAYYVSTPIYYVNDAPHLGHAYTTVAGDVLTRWHRQRGEKVWYLTGTDE
HGQKIMRTAEANGVTPQAWADKLVTESWKPLWEHLDIANDDFIRTTQKRHTDRVQEFVQD
LYDKGEIYKGGYEGPYCVGCEEYKLPGELLDGEGEYAGQKLCPIHKKPVEILSEENYFFK
LSEYSEKLLAHYEANPGFIQPESARNEVVNFVRQGLQDLSISRSTFDWGVPVPWDDKHVI
YVWVDALLNYATAVGYNENPEKFESTFPADVHLVGKDILRFHAIIWPAMLMAQGLPLPGK
IAANGWLMVGGEKMSKSNLTGIKPQDLTSHFGVDAYRWYFLRAIAFGQDGSFSWEDFSAR
YTSELANDYGNLASRVAAMVNKYFGGELPAATADGDAEQAIHDGLAKAVAEADRKIGEEL
DFQGGILAVFDFVKQVNGYITEQEPWKVAKDDSPEGKARLATILYTAAESLRAVAVLLNP
VMPDTSQKLWDSLGAEPSLGALADQRVQHAADWGRLPAGATITKGAVLFPRLEEKPTA
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggcggccactggatcagagaagcagggggcgaaggcgtactacgtctcgacccccatt
tactacgtcaacgacgctcctcacctgggccacgcctatacgaccgtcgcaggcgacgtg
ctcacccgctggcaccgccagcgtggcgagaaggtgtggtacctcaccggcacggacgag
cacggtcagaagatcatgcgtacggccgaggcgaacggggtcaccccgcaggcctgggcc
gacaagctcgtcacggagtcgtggaagcccctgtgggagcacctcgacatcgcgaacgac
gacttcatccgcaccacgcagaagcggcacaccgaccgcgtccaggaattcgtgcaggac
ctgtacgacaagggcgagatctacaagggcggctacgagggcccgtactgcgtgggctgc
gaggagtacaagctccccggcgagctgctcgacggcgagggcgagtacgcgggccagaag
ctgtgcccgatccacaagaagccggtggagatcctcagcgaggagaactacttcttcaag
ctgagcgagtacagcgagaagctgctcgcccactacgaggccaacccgggcttcatccag
cccgagtccgcgcgcaacgaggtcgtgaacttcgtccgccagggcctgcaggacctctcc
atctcccgctcgaccttcgactggggcgtgccggtcccctgggacgacaagcacgtcatc
tacgtgtgggtcgacgccctgctgaactacgcgacggcggtcggctacaacgagaacccg
gagaagttcgagtcgacgttcccggccgacgtgcacctggtcggcaaggacatcctccgc
ttccacgcgatcatctggccggcgatgctgatggcgcagggcctccccctgcccgggaag
atcgcggccaacggctggctgatggtcggcggcgagaagatgtcgaagtccaacctcacc
ggcatcaagccgcaggacctgacctcgcacttcggcgtggacgcgtaccgctggtacttc
ctgcgcgcgatcgcgttcggccaggacggcagcttctcctgggaggacttctccgcccgc
tacaccagcgagctggccaacgactacggcaacctcgcctcccgcgtggcggccatggtc
aacaagtacttcggcggcgagctgccggccgcgacggccgacggcgacgcggagcaggcc
atccacgacggcctggccaaggccgtggccgaggccgaccgcaagatcggcgaggagctg
gacttccagggcggcatcctggcggtcttcgacttcgtcaagcaggtcaacggctacatc
accgagcaggagccctggaaggtcgcgaaggacgacagcccggagggcaaggcccgcctg
gcgacgatcctctacacggccgcggagtccctgcgggcggtggccgtgctgttgaacccg
gtcatgccggacacctcccagaagctctgggactccctcggcgccgagccctccctgggc
gcactcgcggaccagcgggtccagcacgcggcggactggggccggctccccgccggtgcc
acgatcaccaagggcgcggtgctcttcccccgtctcgaggagaagccgaccgcgtaa

DBGET integrated database retrieval system