KEGG   Streptomyces sp. CCM_MD2014: NI25_28660Help
Entry
NI25_28660        CDS       T04862                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
strd  Streptomyces sp. CCM_MD2014
Pathway
strd00670  One carbon pool by folate
strd01100  Metabolic pathways
strd01120  Microbial metabolism in diverse environments
strd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:strd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    NI25_28660
Enzymes [BR:strd01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     NI25_28660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: AIV36962
UniProt: A0A0N6ZPK8
Position
6473003..6473881
Genome map
AA seq 292 aa AA seqDB search
MRDILATGKTTYSFEFSAPKTPKGEKNLWSALRRVEAVAPDFVSVTYGAGGSTRAGTVRE
TEQIVADTTLTPVAHLTAVDHSVAELRNIIGQYADAGIRNMLAVRGDPPGDPTADWIAHP
EGLTYAAELVRLIKESGDFCVGVAAFPEMHPRSADWDTDVAHFVDKCRAGADYAITQMFF
QPESYLRLRDRVAAAGCRTPVIPEVMPVTSVKMLERLPKLSNASFPAELKERILAVKDDP
AAVRSIGIEFATEFCARLLAEGVPGLHFITLNNSTATLEIYENLGLHHPPRA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgacatcctcgccaccggcaagacgacgtactcgttcgagttctcggcgccgaag
acgcccaagggcgagaagaacctgtggagcgcgctgcggcgggtcgaggccgtggccccg
gacttcgtctccgtgacctacggcgccggcggctccacgcgcgccggcacggtccgggag
accgagcagatcgtcgccgacaccaccctgaccccggtcgcccacctcaccgccgtcgac
cactccgtcgccgaactgcgcaacatcatcggccagtacgccgacgccgggatccgcaac
atgctcgccgtgcgcggcgacccgcccggcgacccgaccgccgactggatcgcgcacccc
gagggcctgacgtacgccgccgaactggtccggctcatcaaggagtcgggcgacttctgc
gtcggggtcgccgccttccccgagatgcacccgcgctccgccgactgggacacggacgtg
gcgcacttcgtcgacaagtgccgggccggcgccgactacgcgatcacccagatgttcttc
cagcccgagtcctacctccggctgcgcgaccgggtcgccgcggccggctgccggaccccg
gtcatccccgaggtcatgccggtgaccagtgtgaagatgctggagaggttgccgaagctc
agcaacgcctcgttccccgcggagctgaaagagcggatcctcgcggtcaaggacgatccc
gcggcggtacgctcgatcgggatcgagttcgccacggagttctgcgcgcggctgctggcc
gagggtgtgcccggactgcacttcatcacgctcaacaactccacggctacgctggaaatc
tacgagaatctgggcctgcaccacccaccgcgggcctag

DBGET integrated database retrieval system