KEGG   Streptomyces sp. CCM_MD2014: NI25_32000Help
Entry
NI25_32000        CDS       T04862                                 

Definition
(GenBank) 3,4-dihydroxy-2-butanone 4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
strd  Streptomyces sp. CCM_MD2014
Pathway
strd00740  Riboflavin metabolism
strd00790  Folate biosynthesis
strd01100  Metabolic pathways
strd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:strd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    NI25_32000
   00790 Folate biosynthesis
    NI25_32000
Enzymes [BR:strd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     NI25_32000
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     NI25_32000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: AIV37568
UniProt: A0A0N6ZR81
Position
7200647..7201936
Genome map
AA seq 429 aa AA seqDB search
MSTAPILYSPDGIDDLSLDPVERAVADIAAGRPVVVVDDENRENEGDLVIAAEKATEEIV
AFMMSECRGLICAPMEGEELDRLRLPQMVADNTESMKTAFTVSVDATAAHGVSTGISAAD
RATTLRLLAGGTAEPTDLVRPGHVFPLRARPGGVLVRNGHTEAAVDLARLAGLRPAGAIV
EIAGEDGRMLRLPELIPFARKHGLTIISIEDLIAYRRSEEPTVRREAEVRLPTKHGEFTA
YGYRSTVDGVEHIALVHGEIGDGKDVLVRLHSECLTGDVFGSQRCDCGPQLDASLDRIQA
EGRGVVVYLRGHEGRGIGLMSKLRAYELQERGRDTLDANLELGLPADARDYGAGARILAD
LGVRAVRLMTNNPDKSDALERHGVTVTGREPMPVQAGEHNLRYLRTKRDRMGHDLPWLDT
TPVSTCGNQ
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggcacccatcctctacagcccggacggcatcgacgacctctccctcgacccg
gtcgagcgggcggtcgcggacatcgccgccggccggcccgtggtggtcgtcgacgacgag
aaccgcgagaacgagggcgacctcgtcatcgccgccgagaaggcgaccgaggagatcgtc
gccttcatgatgagcgagtgccgcggcctgatctgcgcgccgatggagggcgaggaactg
gaccggctgcgcttgccgcagatggtcgccgacaacaccgagtcgatgaagaccgccttc
accgtctccgtggacgccaccgccgcccacggcgtcagcaccggcatctccgccgccgac
cgcgccaccaccctccggctcctggccggcggcaccgccgagccgaccgatctggtccgc
cccggtcacgtcttcccgctgcgcgcccggcccggcggtgtcctcgtccgcaacggccac
accgaggccgccgtcgacctcgcccgcctcgcgggcctgcgcccggccggcgccatcgtg
gagatcgccggagaggacgggcgcatgctgcggctgcccgagctgatccccttcgcccgc
aagcacggcctgacgatcatctccatcgaggacctgatcgcctaccggcgcagcgaggaa
cccacggtccgccgcgaggccgaggtccggctgcccacgaagcacggcgagttcacggcg
tacggctaccgctccaccgtcgacggcgtcgagcacatcgccctcgtgcacggcgagatc
ggcgacgggaaggacgtcctggtccgcctccactccgagtgcctcaccggcgacgtcttc
ggatcccagcgctgcgactgcggcccccagctcgacgcctccctggaccgcatccaggcc
gagggcaggggagtggtcgtctacctgcgcggtcacgagggacgcggcatcggcctgatg
tccaagctgcgcgcctacgaactccaggagcgcggccgcgacaccctcgacgccaacctg
gaactcggcctgcccgccgacgcccgcgactacggcgccggggcccggatcctcgccgac
ctcggcgtgcgcgcggtccgcctcatgaccaacaacccggacaagagcgacgccctcgaa
cggcacggcgtcacggtcaccggccgcgaaccgatgcccgtccaggcgggcgagcacaac
ctccgctacctgcgcaccaagcgggaccggatgggacacgacctgccctggctggacacg
acccccgtgtccacctgcggcaaccagtaa

DBGET integrated database retrieval system