KEGG   Streptomyces sp. CCM_MD2014: NI25_33750Help
Entry
NI25_33750        CDS       T04862                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
strd  Streptomyces sp. CCM_MD2014
Pathway
strd00260  Glycine, serine and threonine metabolism
strd01100  Metabolic pathways
strd01110  Biosynthesis of secondary metabolites
strd01120  Microbial metabolism in diverse environments
strd01130  Biosynthesis of antibiotics
strd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:strd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NI25_33750
Enzymes [BR:strd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     NI25_33750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AIV37873
UniProt: A0A0N6ZV47
Position
7585102..7586172
Genome map
AA seq 356 aa AA seqDB search
MNPPKTDARRHHDPEVRGFASDNYAGAHPEVLAALALANGGHQVAYGEDDYTENLQRVIR
SHFGSGAEAFPVFNGTGANVVALQAVTDRWGAVICAESAHINVDEGGAPERMGGLKLLTV
PTPDGKLTPDLIDRQAYGWDDEHRAMPQVVSITQSTELGTLYTPDEIRAICEHAHAHGMK
VHLDGSRIANAAASLNVPMRTFTNAVGVDLLSLGGTKNGALFGEAVVVLNQDAVRHMKHL
RKLSMQLASKMRFVSVQLEALLAKDLWLRNARHSNEMAQRLAEGVRAVHGVEILYPVQAN
AVFARLPHEVSERLQKRFRFYFWDEAAGDVRWMCAFDTTEGDVDAFVAAVKEEMAR
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccccccgaagaccgacgcgcgtcgccatcacgacccggaggtccgcggtttcgcc
agtgacaactacgccggggcccacccggaggtgctcgccgccctggcactggctaacggc
gggcaccaggtcgcgtacggcgaggacgactacaccgagaacctccagcgcgtgatccgc
agccacttcggatccggtgccgaggcgttcccggtcttcaacggcaccggcgccaacgtc
gtcgcgctccaggcggtcaccgaccgctggggcgcggtgatctgcgccgagagcgcgcac
atcaacgtcgacgagggcggcgcccccgagcgcatgggcggtctcaaactgctcaccgtc
ccgacccccgacggcaagctcacccccgacctgatcgaccggcaggcgtacggctgggac
gacgagcaccgcgcgatgccgcaggtcgtctcgatcacccagagcaccgagctgggcacc
ctctacacgcccgacgagatccgcgccatctgcgagcacgcccacgcgcacggcatgaag
gtgcacctggacggctcccggatagccaacgccgccgcctcgctgaacgtgcccatgcgc
acgttcaccaacgcggtcggcgtcgacctcctctccctcggcggcaccaagaacggcgcc
ctgttcggcgaggcggtcgtggtgctgaaccaggacgcggtgcggcacatgaagcacctc
cgcaagctgtccatgcagctcgcctccaagatgcgcttcgtgtcggtccagttggaggcg
ctcctggccaaggacctgtggctgcgcaacgcccggcactccaacgagatggcccagcgt
ctggccgagggcgtgcgcgccgtgcacggtgtggagatcctctacccggtgcaggccaac
gcggtcttcgcccgcctgccgcacgaggtgagcgagcgcctgcagaagcgcttccgcttc
tacttctgggacgaggccgccggggacgtgcgctggatgtgcgccttcgacaccaccgag
ggcgacgtcgacgcgttcgtggccgccgtcaaggaggagatggcgcgctga

DBGET integrated database retrieval system