KEGG   Streptomyces sp. 769: GZL_00105Help
Entry
GZL_00105         CDS       T03587                                 

Definition
(GenBank) oxidoreductase
  KO
K22322  A-factor type gamma-butyrolactone 1'-reductase (1S-forming) [EC:1.1.1.413]
Organism
stre  Streptomyces sp. 769
Brite
KEGG Orthology (KO) [BR:stre00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GZL_00105
Enzymes [BR:stre01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.413  A-factor type gamma-butyrolactone 1'-reductase (1S-forming)
     GZL_00105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AJC52713
UniProt: A0A0A8F5R8
Position
complement(151794..152666)
Genome map
AA seq 290 aa AA seqDB search
MCGRRRLAGWRAGQRWWQPELSGQESGDEEQAEMTYEHGLLTDRVVMITGASSGIGAAAA
RLFAAEGAAVVLMARREERLRMLAGEIEARGGRAAVAAGSVTCEDDVEKAVATAVECFGH
LDGAFNNAGWAEAGRLLHETDNEVFDRVMDVNVRGVWNCLRHQLPAMLACGRDAAVVNTS
SVAGRQATGAGSPYVAAKHAVLGLTRAAAAEYGERGIRVNALMVGSTRTELMDEVLADAP
ALEAAFVARSSQKRMADPVEIAQAAVWLCSDRASFVTGAAVPVDGGWTAA
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtgtgcggaagaaggcgtctggccggctggagagccggacagcggtggtggcagccggag
ctgtcaggccaggagtcgggagatgaggaacaggctgagatgacttatgagcatgggttg
ttgaccgacagggttgtcatgattacgggcgcttccagcgggattggcgccgccgcggca
cggctgttcgctgccgagggagccgcggtggtgctgatggcgcgccgggaggagcggctg
cgtatgttggccggggagatcgaggcacgaggcggccgtgcggcggtggcggccgggagt
gtgacctgtgaggacgacgtcgagaaggccgttgcgacggcggtggagtgcttcggccac
ctggacggcgcgttcaacaacgcaggctgggccgaggcgggaagactcctgcacgagacg
gacaacgaggtcttcgaccgtgttatggacgtgaatgtacgaggggtgtggaactgcctg
cgtcatcagcttccggctatgctcgcctgcggccgtgacgcagcagtggtcaacacctcc
agtgtggcgggccgccaggccaccggtgcgggctccccgtacgtcgccgccaagcacgcg
gtgctggggctgaccagagcggcggcggccgagtacggcgagcgcgggatccgggtcaac
gccttgatggtgggcagtacgcgcaccgagctgatggacgaagtcctggcggacgccccg
gcgttggaggccgccttcgttgcgcgctcgagccagaagcgtatggccgaccccgtggag
atcgcgcaggcagcggtgtggctgtgcagcgaccgggcgtctttcgtgaccggtgcggcg
gtaccggtggacggcggttggaccgccgcgtag

DBGET integrated database retrieval system