KEGG   Streptomyces sp. 769: GZL_01558Help
Entry
GZL_01558         CDS       T03587                                 

Definition
(GenBank) hypothetical protein
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
stre  Streptomyces sp. 769
Pathway
stre00903  Limonene and pinene degradation
stre00930  Caprolactam degradation
stre01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:stre00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    GZL_01558
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    GZL_01558
Enzymes [BR:stre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     GZL_01558
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Peptidase_S9 COesterase
Motif
Other DBs
NCBI-ProteinID: AJC54156
UniProt: A0A0A8EJD6
Position
1642521..1643570
Genome map
AA seq 349 aa AA seqDB search
MRVKDSQGGQDAAAVHLRRGGPAMVSIDVPVFYQEWATRSGGVIDAAAGVGPDTVEDARL
AYRKFFQDSFPVPDGVTFDSVDADGVAAQCATPADAVPGRHLVYLHGGAYLAGDPQGYRG
LVGDLARRLRARVVVPHYRLAPEAVFPAPIEDAVTAYRWLLEEGAEPHNVVLAGDSAGGA
MAVSALVAARDQGLPMPAASIAISPWANLEHTGATMFTLDGVDPSVNRAGLSRAADIVLG
GAPRNNPLASPVFADTRGLPPVLIQTGGHEVMLSDAVRLAAKLAEDSVPLRLDVAPGMGH
VWHLLAAHLPAADKAVADAVAFAEEHLPAAVAEENVEGLGRPQPSRLSI
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
gtgagggtcaaagactcgcagggcggccaggacgcggccgctgtgcatctgcgacgagga
ggacctgccatggtctcgatcgatgttcccgtcttctaccaggaatgggcgactcgcagc
ggcggtgtcatcgacgctgccgccggggtaggccccgacactgtggaggacgcccggctc
gcctaccggaagttcttccaggacagctttccggtaccggacggggtgaccttcgactcc
gtggacgcggacggggtggccgcccagtgcgcgactcccgcggacgccgtccccggccgg
cacctggtctatctccacggtggcgcctacctggcgggagacccgcagggctaccgtggc
ctggtcggcgatctcgcccgacgcctgcgcgcccgcgttgtggtcccgcactaccggctc
gcgcccgaggcggtcttccccgcccccatcgaggacgccgtcaccgcttaccgctggctg
ctggaagagggcgccgaaccgcacaacgtggtgctcgccggcgactccgccggtggcgcg
atggcggtcagcgccctggtcgccgcccgtgaccagggacttccgatgccggccgcctcg
atcgccatctccccctgggccaacctcgaacacaccggggccacgatgttcacgctggac
ggcgtggacccgtccgtcaaccgtgcggggctgagccgcgccgcggacatcgtcctgggc
ggcgccccgcggaacaacccgctggcctcgccggtcttcgccgacacccgcggactgcct
ccggttctgatccagaccggcggtcacgaggtcatgctcagcgacgcggtcaggctggcc
gccaagctggccgaggactccgtacccctgcgcctggatgtcgcgccggggatgggacac
gtgtggcatctgctcgccgctcacctccctgccgcggacaaggcggtcgccgacgccgtc
gccttcgccgaggagcaccttcctgccgcggtcgccgaggagaacgtcgagggcctcggc
cgccctcagccatcccgcctctcgatatag

DBGET integrated database retrieval system