KEGG   Streptomyces sp. 769: GZL_04182Help
Entry
GZL_04182         CDS       T03587                                 

Definition
(GenBank) putative low-affinity inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
stre  Streptomyces sp. 769
Brite
KEGG Orthology (KO) [BR:stre00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    GZL_04182
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Myc_target_1
Motif
Other DBs
NCBI-ProteinID: AJC56764
UniProt: A0A0A8ELS2
Position
complement(4527416..4528414)
Genome map
AA seq 332 aa AA seqDB search
MDTFALVVTIAVALGFTYTNGFHDSANAIATSVSTRALTPRAALAMAAVMNLAGAFLGSG
VAKTVSEGLIATPHGSKGMGILFAALLGAVVWNLVTWYFGLPSSSSHALFGGMVGAALAG
GTQVIWSGVVEKVVLPMFISPVIGLVLGYLVMVVILWLFRKANPHKAKRGFRIAQTVSAA
GMALGHGLQDAQKTMGIVVMALVIADVEKADDAIPLWVKLACAITMSLGTYAGGWRIMRT
LGRRIIELDPPQGFAAETTSASVMYVASFMFHAPISTTHVITASIMGVGSTKRPRAVRWG
VAKNIVMGWFITMPAAALVAGLAFWLIKLAFG
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggacaccttcgcactcgtcgtgaccattgcggtcgcgctcggtttcacctataccaac
ggcttccacgactcggcgaacgcgatcgcgacctcggtctcgacgcgggccctgaccccg
cgcgccgcgctggcgatggcggccgtgatgaacctcgccggcgccttcctgggcagcggc
gtcgccaagacggtcagcgaggggctgatcgcgaccccgcacggcagcaaggggatgggc
atcctcttcgccgcgctgctcggcgcggtcgtctggaacctcgtcacctggtacttcggc
ctgccgtcgtcctcctcgcacgcgctgttcggcggcatggtcggcgcggcgctggccggc
gggacgcaggtgatctggtccggcgtggtcgagaaggtcgtcctgccgatgttcatctcg
ccggtgatcgggctggtgctcggctacctcgtgatggtcgtgatcctctggctgttccgg
aaggccaacccgcacaaggccaagcgcggcttccgcatagcgcagaccgtctcggccgcg
ggcatggcactcggccacggcctccaggacgcccagaagaccatgggcatcgtggtgatg
gccctggtcatcgccgacgtcgagaaggccgacgacgccattccgctgtgggtcaagctg
gcctgcgcgatcaccatgtcgctcggcacctacgcgggcggttggcgcatcatgcggacg
ctgggccggcggatcatcgagctggacccgccgcagggcttcgccgcggagaccacgtcc
gcctcggtgatgtacgtggcgtccttcatgttccacgcgccgatctccaccacgcacgtc
atcaccgcctcgatcatgggcgtgggctcgaccaagcgcccgcgtgcggtgcgctggggc
gtggccaagaacatcgtgatgggctggttcatcaccatgccggccgcggcgctggtcgcc
ggtctggcgttctggctgatcaagctggcgttcggctga

DBGET integrated database retrieval system