KEGG   Streptomyces sp. 769: GZL_06651Help
Entry
GZL_06651         CDS       T03587                                 

Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
stre  Streptomyces sp. 769
Pathway
stre00860  Porphyrin and chlorophyll metabolism
stre01100  Metabolic pathways
Module
stre_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:stre00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GZL_06651
Enzymes [BR:stre01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     GZL_06651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 SNO GATase Peptidase_S51
Motif
Other DBs
NCBI-ProteinID: AJC59218
UniProt: A0A0A8ETQ5
Position
complement(7168168..7169676)
Genome map
AA seq 502 aa AA seqDB search
MGGGLLVAGTTSDAGKSVVTAGICRWLVRQGVSVAPFKAQNMSLNSFVTREGAEIGRAQA
MQAAAARVEPTALMNPVLLKPGSDRSSQVVLLGKPVGELSARGYHSGRQEQLLGTVTDCL
AELRRTHDAVICEGAGSPAEINLRRTDIVNMGIARAARIPVVVVGDIDRGGVFASFFGTT
ALLSEEDQALVAGYLVNKFRGDVTLLEPGLEMLRGLTGRRTYGVLPYAHGLGIDEEDGLR
VSLRGAVRESVVAPPAGEDILRVAVCAVPLMSNFTDVDALAAEPGVVVRFVDRPEELADA
DLVVLPGTRGTVRALAWLRERGLADAVVRRAAEGRPVLGVCGGFQMLGERIEDEVESRAG
TVDGLGLLPVRVRFAVEKTLARPSGEALGEPVEGYEIHHGVAEVAGGDEEFLDGCRVGAV
WGTHWHGSLESDGFRRAFLREVARAAGRRFVPAPDTRFGALREEQLDRLGDLIEEHADTK
ALLRLIEEGVPEGLPFVPPGAP
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtgggcggcgggctgctggtggccgggacgacgtccgacgccggcaagagcgtggtgacc
gccggcatctgccgttggctggtccggcagggcgtctcggtggcgcccttcaaggcgcag
aacatgtcgctgaactcgttcgtgacccgggagggcgcggagatcggccgggcgcaggcg
atgcaggcggccgcggcccgggtcgagccgaccgcgctgatgaacccggtgctgctcaag
ccgggcagcgaccgcagcagccaggtggtgctgctggggaagccggtgggcgagctgagc
gcgcgcggctaccactccggccggcaggagcagttgctgggcaccgtgacggactgcctg
gcggagctgcggcgcacccacgacgcggtgatctgcgagggcgccggcagccccgccgag
atcaacctgcggcgcaccgacatcgtcaacatgggcatcgcccgggcggcacggatcccg
gtggtggtggtcggcgacatcgaccggggcggggtcttcgcctcgttcttcggcaccacc
gcgctgctgtcggaggaggaccaggcgctggtcgccggctatctcgtcaacaagttccgc
ggcgatgtgacgctgctggagccggggctggagatgctgcgcgggctcaccggccggcgc
acctacggcgtcctgccgtacgcgcacgggctgggcatcgacgaggaggacggactgagg
gtgtcgctgcgcggcgcggtccgcgagtcggtggtggcgccgccggccggcgaggacatc
ctccgggtcgcggtgtgcgcggtgccgctgatgtccaacttcaccgacgtggacgcgctg
gcggccgaaccgggcgtggtggtgcggttcgtggaccggcccgaggagttggccgacgcg
gacctggtggtgctgccggggacccgcggcacggtccgcgcgctggcctggctgcgggag
cgcgggctggcggacgcggtggtccggcgggccgcggagggccgcccggtgctgggcgtc
tgcggcggtttccagatgctcggcgagcgcatcgaggacgaggtcgagtcgcgggcgggc
acggtggacgggctggggctgctgccggtccgggtgcggttcgcggtggagaagacgctc
gcccggccgtccggcgaggcgctgggggagccggtggaggggtacgagatccaccacggc
gtcgccgaagtggccgggggcgacgaggagttcttggacgggtgccgggtgggtgccgtg
tggggcacgcactggcacggctccctggagagcgacgggttccggcgggcgttcctgcgg
gaggtggcccgggcggccggccgccggttcgtgccggcgccggacacccgcttcggcgcg
ctgcgcgaggagcagctggaccggctgggcgatctgatcgaggagcacgcggacacgaag
gcgctgctgcggctgatcgaggagggggtgccggaggggctgccgttcgttcctccgggg
gcgccgtga

DBGET integrated database retrieval system