KEGG   Streptomyces sp. 769: GZL_08019Help
Entry
GZL_08019         CDS       T03587                                 

Definition
(GenBank) pyridoxal-dependent decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
stre  Streptomyces sp. 769
Pathway
stre00350  Tyrosine metabolism
stre00360  Phenylalanine metabolism
stre00380  Tryptophan metabolism
stre01100  Metabolic pathways
stre01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:stre00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    GZL_08019
   00360 Phenylalanine metabolism
    GZL_08019
   00380 Tryptophan metabolism
    GZL_08019
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:stre04147]
    GZL_08019
Enzymes [BR:stre01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     GZL_08019
    4.1.1.105  L-tryptophan decarboxylase
     GZL_08019
Exosome [BR:stre04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GZL_08019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 SepSecS DegT_DnrJ_EryC1 Aminotran_1_2 Beta_elim_lyase DUF412
Motif
Other DBs
NCBI-ProteinID: AJC60567
UniProt: A0A0A8EYN3
Position
complement(8602335..8603768)
Genome map
AA seq 477 aa AA seqDB search
MTPDEFRRHGRQVVDWIAAYQEKIESYPVRSQVAPGEVLEALPPSPPETGEGFEGVLADL
DRVLMPGITHWQHPSFFAYFPANASGPAILGDLLSSGLGVQGMLWATSPACTELETRVVD
WLAQLLELPEAYRGNGVIQDSASSASLVAVVAALHRAGGGKPGRDGVSARYTLYTSSQTH
SSLEKAARICGIGAAAVRVVDVDPQTLAMDPACLETTIARDRAAGAVPLLVCATVGTTST
TAIDPVPEIGVVCRRNGAWLHVDAAYAGVAAVCPELRWLNDGLAQYADSYVTNPHKWMLT
NFDCTALWVADRAPLVGALSVLPEYLRNQATASGEVIDYRDWQIPLGRRFRALKLWSVIR
WYGAQGLRAHIRSGIGLAQELAGWIEADAAFHLHPHHPLGLVCFRPLWPRLPEAEADAAT
LRMMQGLNDSGELYLTHTKAGGRVLLRMAIGAPGTELRHVRLAWDRIAAAVRAETAP
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgacgccggacgagttccggcgtcacggccggcaggtggtcgactggatcgccgcctac
caggagaagatcgagtcgtacccggtgcgttcgcaggtcgcgccgggtgaggtgctggag
gcgctgccgccgagcccaccggagacgggcgagggcttcgagggggtgttggcggacctg
gaccgggtgctgatgccaggcatcacgcactggcagcatccctcgttcttcgcctacttc
cccgccaacgccagcggcccggcgatcctgggcgaccttctctcgtccggactgggcgtt
cagggcatgctgtgggcgaccagtccggcctgcaccgagctggagacccgcgtggtcgac
tggctggcgcagctgctggaactgccggaggcgtaccggggcaacggtgtcatccaggac
tcggcgtccagcgcctcgttggtggcggtcgtcgccgcgctgcaccgagcgggcggggga
aagcccgggcgggacggcgtcagcgcgcggtacacgctctacaccagctcacagacccac
tcctcactggagaaggccgcgcggatctgtggaatcggcgcggctgccgtgcgggtggtg
gacgtcgatccacagaccctggcgatggacccggcctgcctggaaacgacgatcgcccgg
gaccgcgccgcgggcgccgtgccgctgctggtgtgtgcgacggtcggcacgacctcgacc
accgccatcgacccggtgcccgagatcggcgtggtgtgccgccgcaacggtgcctggctg
cacgtggacgcggcctatgcgggcgtggcggcggtgtgcccggaactgcggtggctcaac
gacggactggcgcagtacgccgactcctacgtcaccaacccgcacaagtggatgctcacc
aacttcgactgcaccgcgctgtgggtggccgaccgcgcaccgctggtgggtgcgctctcg
gtcctccccgagtacctgcgcaaccaggccaccgcctcgggcgaggtcatcgactaccgc
gactggcagatcccgctcggccgccgttttcgcgccctgaagctgtggtcggtgatccgc
tggtacggggcgcaggggctgcgggcgcacatccgcagcggtatcggcctggcacaggag
ctggccgggtggatcgaggccgatgcggcattccacctgcacccgcaccacccgctgggc
ctggtctgtttccgcccgctgtggccccggctgcccgaagccgaggcggacgcggccacg
ctgcggatgatgcaagggctgaacgactccggcgagctgtacctcacccacaccaaggcc
ggcggccgggtgctgctgcggatggccatcggcgctccgggcaccgagctgcggcacgtg
cgactggcctgggaccggatcgccgccgccgtacgcgccgagaccgcaccctga

DBGET integrated database retrieval system