KEGG   Streptomyces sp. 769: GZL_08177Help
Entry
GZL_08177         CDS       T03587                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
stre  Streptomyces sp. 769
Pathway
stre00620  Pyruvate metabolism
stre00630  Glyoxylate and dicarboxylate metabolism
stre01100  Metabolic pathways
stre01110  Biosynthesis of secondary metabolites
stre01120  Microbial metabolism in diverse environments
stre01200  Carbon metabolism
Module
stre_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:stre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GZL_08177
   00630 Glyoxylate and dicarboxylate metabolism
    GZL_08177
Enzymes [BR:stre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     GZL_08177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AJC60717
UniProt: A0A0A8EYX4
Position
complement(8754610..8755515)
Genome map
AA seq 301 aa AA seqDB search
MLGIPRGTIRATVLIETITAAVEMEEILYELREHSSGLNAGRWDYLFSLIKTFGHRTDFL
LPDRARVTMTAPFMRAYTELLVRTCHRRGAHAIGGMAAQVPGTDPAARQAALATVRLDKE
REAEDGFDGSWVAHPGLVPVCQAAFDEVLGARPHQLDRTRDEVAVTAADLLSVRRTSGPP
TPDGVRTNIAVALRYFDAWLRGQGAVALDGLMADAATAEIARVQIWQWLRHRVIDRASVL
RLLDDELAALGAAFPWAGLDEVRGLFERTALADALPPFFTADAYARHLAPGRAAGRGAHA
G
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgctcggcatcccgcgcggcacgatccgcgccaccgtcctcatcgagaccatcaccgcc
gcggtcgagatggaggagatcctctacgagctgcgcgagcacagctcgggtctgaacgcg
ggccgctgggactatctgttcagcctgatcaagacgttcgggcaccgcaccgacttcctg
ctgccggaccgcgccagggtgacgatgaccgcccccttcatgcgggcctacaccgagctc
ctcgtgcgcacctgccaccggcgcggcgcccacgccatcggcgggatggccgcacaggtg
ccgggcacggacccggcggcgcgccaggcggcgctcgccacggtgcggctggacaaggaa
cgcgaggccgaggacggcttcgacgggtcctgggtggcccatcccggtctggtgccggtg
tgccaggcggcgttcgacgaggtgctgggcgcgcgcccgcaccagctggaccgcacccgg
gacgaggtggcggtgacggctgcggacctgctgtcggtgcgccggaccagcgggccgccc
acgccggacggggtccggacgaacatcgcggtcgcgctgcgctacttcgatgcctggctg
cgcgggcagggggccgtcgcgctggacgggctgatggcggacgcggcgaccgcggagatc
gcccgggtgcagatctggcagtggctgcggcaccgggtgatcgaccgggcgtcggtgctg
cggctgctcgacgacgaactcgccgcgctcggcgccgcgttcccgtgggcgggcctggac
gaggtgcgggggctcttcgagcggacggcgctcgccgacgcgctgccgccgttcttcacc
gccgacgcctacgcccgccacctcgcgccgggccgcgcggccggccgcggcgcccacgcc
gggtag

DBGET integrated database retrieval system