KEGG   Streptomyces sp. 769: GZL_09051Help
Entry
GZL_09051         CDS       T03587                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
stre  Streptomyces sp. 769
Pathway
stre00450  Selenocompound metabolism
stre00970  Aminoacyl-tRNA biosynthesis
stre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stre00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    GZL_09051
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    GZL_09051
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:stre01007]
    GZL_09051
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:stre03016]
    GZL_09051
Enzymes [BR:stre01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     GZL_09051
Amino acid related enzymes [BR:stre01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   GZL_09051
Transfer RNA biogenesis [BR:stre03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    GZL_09051
 Prokaryotic type
   Other AARSs
    GZL_09051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g Cupin_2 PP-binding AraC_binding tRNA-synt_1 Cupin_1 Cupin_3 Laminin_EGF tRNA-synt_1e Ectoine_synth
Motif
Other DBs
NCBI-ProteinID: AJC61574
UniProt: A0A0A8F0V7
Position
complement(9623125..9625359)
Genome map
AA seq 744 aa AA seqDB search
MRIDTFDPATLSDAFGIDMSTIDLPGVAGLGAGWGRVPPGGRSEPHQHDEIEMFVIVSGT
GEIVVDGARHPVGPGTVVKFDPFETHVIDNTGDGDVVFVTCYWREPRHAGEVAARPDRRR
FGERPVFVFSTPPTPNGDLHLGHLSGPYLGADAFVRFQRMNGVRAWHLTGSDDHQSYVVA
KAAQEGSTPEQVAAHYGAEIARTLESMDIRPDQFTVTRTDAGYRQGLRDFFAALETSGQV
ARRELPALFDGKTGRYLYEVDVSGTCPSCEAGTNGNICEECGEPNTVADLVEARSRHSDT
VRAEGLARHALALHEFREDVARHHQLGRVPARLRELAQRVFARQTFDLPLTHPAQWGVPP
RDADDQVIWVWPEMSYGFLHGIGQLGARIGERWQAHKPEQDWKIVHFFGYDNSFYHAILY
PVLYQLAFPHWQPDIDYHVNEFYLLDDQKFSTSRRHAVWGKDLLCPETVDAVRFYLSRTR
PEGERTNFERDAYTATVREVLIEGWQGWLDDLDRRLKARYGGVVPDAGTWTPEHTAFYAR
LGRRLAAVTAHLGQDGFSLRAATAELEGIVTDARAFAGHEAGLADAAGWQSENRTAMALE
VAAARLLSRVATPVMPRFAGRLAALLGEREPAWPTTVDLVPAGTEVDLSGQVFFAAEPTS
AQAAEAAPDPLPWLADLVRTTLGLPAEAVVADKTLLELGASSLQAVAVQYQILERLDLDI
PMAELLSERNIGTLGRDLAQEVAR
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
ttgagaatcgacaccttcgaccccgcgacgctcagcgatgccttcgggatcgacatgagc
acgatcgacctgcccggtgtcgccgggttgggtgcggggtggggccgggtgccgccgggc
gggcgctccgagccgcaccagcacgacgagatcgagatgttcgtcatcgtgtccggcacc
ggcgagatcgtggtggacggggcgcgccatccggtgggcccgggcaccgtcgtcaagttc
gacccgttcgagacccacgtgatcgacaacaccggtgacggcgacgtggtgttcgtgacc
tgctactggcgcgagccccggcacgccggcgaggtggccgcgcgtcccgaccggcggcgt
ttcggggagcgtccggtgttcgtcttctccaccccgccgacccccaacggcgacctgcac
ctggggcacctgtccgggccgtacctcggcgcggacgcgttcgtccggttccagcgcatg
aacggggtgcgggcctggcatctgaccggcagcgacgaccaccagagctatgtggtggcc
aaggcggcgcaggaggggagcactcccgagcaggtcgccgcgcactacggcgccgagatc
gccaggacgctggagtcgatggacatccggcccgaccagttcacggtgacccgcacggac
gccggataccgtcagggcctgcgcgacttcttcgccgcgttggagacgtccggccaggtg
gcccggcgcgaactgccggcgctgttcgacgggaagaccggccgctacctctacgaggtc
gatgtgtccggtacctgcccgtcctgcgaggccggcaccaacggcaacatctgcgaggag
tgcggcgagcccaacaccgtcgccgacctcgtcgaggcacggagccggcactcggacacg
gtgcgggccgagggcctggcccggcacgcgctggcgctgcacgagttccgcgaggacgtc
gcccggcaccaccaactcggccgggtccccgcccggctgcgcgaactggcccaacgggtc
ttcgcccggcagaccttcgatctgccgctgacccaccccgcgcagtggggcgtccccccg
cgggacgccgatgaccaggtgatctgggtgtggccggagatgtcgtacggcttcctgcac
ggcatcgggcagctcggcgcccggatcggcgagcggtggcaggcgcacaagccggagcag
gactggaagatcgtccacttcttcggctacgacaacagcttctaccacgcgatcctctac
ccggtgctgtaccagctggcgttcccgcactggcagccggacatcgactaccacgtcaac
gagttctatctgctggacgaccagaagttctccaccagccggcggcacgcggtgtggggc
aaggacctgctgtgcccggagacggtggacgcggtgcggttctacctctcccgtacgcgc
ccggagggcgagcgcaccaacttcgagcgggacgcctacaccgcgaccgtgcgcgaggtg
ctgatcgagggctggcagggctggctcgacgacctcgaccggcggctgaaggcgcgctac
ggcggtgtggtgccggacgccgggacctggacgcccgagcacaccgcgttctacgcccgg
ctcggcaggcgcctggcggccgtgacggcgcacctgggccaggacgggttctccctgcgg
gcggccaccgccgagctggagggcatcgtcaccgacgcgcgggcgttcgccgggcatgag
gcggggctcgccgacgcggccggctggcagtcggagaaccgcacggcgatggcgttggaa
gtcgccgcggcccggctgctgtccagggtcgccacaccggtcatgccgcgcttcgccggg
cgcctcgccgcgctgctcggcgagcgcgagccggcctggcccaccaccgtggacctggtt
ccggccgggaccgaagtggacctgagcgggcaggtgttcttcgccgccgagccgacatcc
gcgcaggcggcggaggcggcgccggacccgctgccctggctcgccgacctggtccgcacg
acgctcggcctgcccgcggaggccgtggtggccgacaagaccctgctcgaactcggcgcg
tcctcgttgcaggcggtcgcggtgcagtaccagatcctggaacgactggacctcgacata
ccgatggcggagctgctctccgagcggaacatcggcacgctcggccgcgacctggcccag
gaggtggcccgatga

DBGET integrated database retrieval system