KEGG   Streptomyces sp. 4F: ASR50_15515Help
Entry
ASR50_15515       CDS       T04265                                 

Definition
(GenBank) tryptophan 2,3-dioxygenase
  KO
K00453  tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
strf  Streptomyces sp. 4F
Pathway
strf00380  Tryptophan metabolism
strf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:strf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    ASR50_15515
Enzymes [BR:strf01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     ASR50_15515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_dioxygenase
Motif
Other DBs
NCBI-ProteinID: ALV50682
UniProt: A0A0U3QZF1
Position
complement(3512583..3513428)
Genome map
AA seq 281 aa AA seqDB search
MSHEAHEPETPHLAPKIDWSQGTTPYEDYVKADVLTHLQHTLSDDPGEMVFLVTTQVMEL
WFTVIVHEWETAAQALRRDDVPTAVDALRRSRRELEALNASWRPLAGLTPAQFNSYRSAL
GEGSGFQSAMYRRMEFLLGDKSASMLVPHRGAPRVHAELEKALHEPSLYDEVLRFLARRG
HPVPKDVLERDVSRKYEPSREVEEIWTAVYAGDERDEVARLGEALTDVAELVWRWRNDHL
VATRRAMGSKTGTGGSAGVAWLEKRAQKNVFPELWTARSYV
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgtcccacgaggctcacgagcccgagaccccgcatctcgcccccaaaattgattggagc
cagggcacgacgccttacgaggactacgtcaaggccgacgtcctcacccacctccagcac
accctctcggacgatcccggagagatggtcttcctggtcaccacccaggtcatggaattg
tggttcaccgtgatcgtgcacgagtgggagaccgcggcgcaggcgctgcgccgcgacgac
gtgccgaccgcggtcgacgcgctgcgccgctcacggcgcgagctggaggcgctgaacgcc
tcctggcggcccctggccgggctcaccccggcccagttcaactcctaccggagcgccctc
ggcgagggctccggcttccagtcggcgatgtaccggcgcatggagttcctgctcggcgac
aagtccgcgtcgatgctggtcccgcaccggggggcgccgcgggtgcacgccgaactggag
aaggccctgcacgagcccagcctctacgacgaggtgctgcggttcctcgcccggcgcggc
caccccgtgccgaaggacgtgctggagcgcgacgtgtcgcggaagtacgagccgtcgcgc
gaggtcgaggagatctggacggccgtctacgcgggcgacgagcgggacgaggtggcgcgg
ctcggcgaggcgctgaccgacgtcgccgagctggtgtggcgctggcgcaacgaccacctg
gtcgccacccgccgggccatgggttccaagaccgggacgggagggtccgccggagtggcg
tggctggagaagcgggcgcagaagaacgtgttccccgagctgtggacggcgcggtcctat
gtctga

DBGET integrated database retrieval system