KEGG   Streptomyces sp. 4F: ASR50_16465Help
Entry
ASR50_16465       CDS       T04265                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
strf  Streptomyces sp. 4F
Pathway
strf00450  Selenocompound metabolism
strf00970  Aminoacyl-tRNA biosynthesis
strf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:strf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ASR50_16465
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ASR50_16465
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:strf01007]
    ASR50_16465
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:strf03016]
    ASR50_16465
Enzymes [BR:strf01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     ASR50_16465
Amino acid related enzymes [BR:strf01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   ASR50_16465
Transfer RNA biogenesis [BR:strf03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    ASR50_16465
 Prokaryotic type
   Other AARSs
    ASR50_16465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 DUF1659
Motif
Other DBs
NCBI-ProteinID: ALV50848
UniProt: A0A0U3PZG5
Position
complement(3712400..3714016)
Genome map
AA seq 538 aa AA seqDB search
MAATGSEKQGAKAYYVTTPIYYVNDAPHLGHAYTTVAGDVLTRWHRQRGEKVWYLTGTDE
HGQKIMRTAEANGVTPQAWADKLVTEAWQPLWEHLDIANDDFIRTTQKRHTDRVQEFVQD
LYDKGEIYKGGYEGPYCVGCEEYKLPGELLDGEGDYAGQKLCPIHKKPVEILSEENYFFK
LSEYSEKLLAHYEANPGFIQPESARNEVVNFVRQGLQDLSISRSTFDWGVKVPWDDKHVI
YVWVDALLNYATAVGYNENPEKFGSTFPADVHLVGKDILRFHAIIWPAMLMAQGLPLPGK
VAANGWLMVGGEKMSKSNLTGIKPQDLTSHFGVDAYRWYFLRAIAFGQDGSFSWEDFSAR
YTSELANDYGNLASRVAAMVGKYFGGELPAATADGDAEKAVHEGLAKAVAEADRKIGEEL
DFQGGILAVFDFVKQVNGYITEQEPWKVAKDDSPEGKARLATILYTAAESLRAVAVLLNP
VMPETSQKLWDSLGAEPALGALADQKVQESATWGLLPAGSTVTKGAVLFPRLEEKPTA
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggcggccactggatcagagaagcagggggcgaaggcgtactacgtcacgacccccatc
tactacgtcaacgacgctcctcacctgggccacgcctacacgaccgtcgcaggcgacgtg
ctcacccgctggcaccgccagcgtggcgagaaggtgtggtacctcaccggcacggacgag
cacggtcagaagatcatgcgcacggccgaggcgaacggggtcaccccgcaggcctgggcc
gacaagctcgtcacggaggcctggcagcccctgtgggagcacctcgacatcgcgaacgac
gacttcatccgcaccacgcagaagcggcacaccgaccgcgtccaggagttcgtgcaggac
ctgtacgacaagggcgagatctacaagggcggctacgagggcccgtactgcgtgggctgc
gaggagtacaagctccccggcgagctgctcgacggcgagggcgactacgccggccagaag
ctgtgcccgatccacaagaagccggtggagatcctcagcgaggagaactacttcttcaag
ctcagcgagtacagcgagaagctgctcgcgcactacgaggccaacccgggcttcatccag
cccgagtccgcgcgcaacgaggtcgtgaacttcgtccgccagggcctgcaggacctctcc
atctcccgctcgacgttcgactggggcgtcaaggtcccgtgggacgacaagcacgtcatc
tacgtgtgggtcgacgcgctgctgaactacgcgacggccgtcggctacaacgagaacccg
gagaagttcgggtcgacgttccccgccgacgtccacctggtcggaaaggacatcctccgc
ttccacgcgatcatctggccggccatgctgatggcgcagggcctcccgctgcccgggaag
gtcgccgcgaacggctggctgatggtcggcggcgagaagatgagcaagtccaacctgacc
ggcatcaagccgcaggacctgacctcgcacttcggcgtggacgcgtaccgctggtacttc
ctgcgcgcgatcgcgttcggccaggacggctccttctcctgggaggacttctccgcccgc
tacaccagcgagctggcgaacgactacggcaatctcgcctcccgcgtggcggcgatggtc
ggcaagtacttcggcggcgagctgccggccgccacggccgacggcgacgcggagaaggcg
gtccacgagggcctggcgaaggcggtcgcggaggcggaccggaagatcggcgaggagctg
gacttccagggcggcatcctggcggtcttcgacttcgtgaagcaggtcaacggctacatc
accgagcaggagccctggaaggtcgccaaggacgactcgccggagggcaaggcccgcctg
gcgacgatcctctacacggccgcggagtcgctccgcgcggtggccgtcctgctcaacccg
gtgatgccggagacctcccagaagctgtgggactccctcggcgcggagcccgccctgggc
gccctcgccgaccagaaggtccaggagtcggccacctggggtctcctccccgccggctcc
acggtcaccaagggcgcggtcctcttcccccgcctggaggagaagcccaccgcgtaa

DBGET integrated database retrieval system