KEGG   Streptomyces sp. 4F: ASR50_23455Help
Entry
ASR50_23455       CDS       T04265                                 

Definition
(GenBank) phosphoesterase
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
strf  Streptomyces sp. 4F
Brite
KEGG Orthology (KO) [BR:strf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ASR50_23455
Enzymes [BR:strf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     ASR50_23455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP Glyco_hydro_114
Motif
Other DBs
NCBI-ProteinID: ALV54566
UniProt: A0A0U3HSP5
Position
5210680..5211540
Genome map
AA seq 286 aa AA seqDB search
MRIDLHTHSTASDGTDTPAELVRKAAAAGLDVVALTDHDTTRGHVEALAALPQGLTLVTG
AELSCRLDGVSMHLLAYLFDPEEPALLAERELVRDDRVPRAKGMIAKLNELGVPVTWEQV
ARIAGNGSVGRPHVASALVELGVVDSVSDAFTPEWLADGGRAYVPKHETDPFEAVRLVKN
AGGVAVFAHPAAVKRGRTVPDSAIAELARAGLDGIEVDHMDHDPGTRGRLRGLAGELELL
VTGSSDYHGSRKTCVLGEFSTDPEVYGEITRRATGAFPVPGTGGAV
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcatcgacctgcacacccactccaccgcgtccgacggtacggacaccccggccgag
ctggtccgcaaggccgccgcggccggactcgacgtcgtggccctcaccgaccacgacacc
acgcgcggccacgtcgaggcgctcgcggcgctgccccagggactcaccctggtcaccggc
gccgagctctcctgccgcctcgacggcgtcagcatgcatctgctggcctacctcttcgat
cccgaggagcccgccctgctcgccgaacgcgagctggtcagggacgaccgggtgccgcgc
gccaagggcatgatcgccaagctgaacgagctgggcgtgcccgtcacctgggaacaggtc
gcgcggatcgccgggaacggctcggtgggccgcccgcacgtcgccagcgcgctggtcgag
ctcggcgtggtggacagcgtgagtgacgccttcacgcccgagtggctcgccgacggcggc
cgggcgtacgtgcccaagcacgagaccgaccccttcgaggcggtccggctggtgaagaac
gcgggcggcgtcgccgtcttcgcgcaccccgccgcggtgaagcggggcaggaccgtgccg
gactccgcgatcgcggaactggcccgggccggtctggacggcatcgaggtcgaccacatg
gaccacgaccccggcacccgggggcggctgcgcggcctggcgggcgagctggagctgctg
gtcaccgggtcgagcgactaccacggcagccggaagacctgcgtcctcggcgagttctcc
accgaccccgaggtctacggcgagatcacgcggcgcgcgaccggggcgttcccggtgccg
gggaccggcggagcggtctga

DBGET integrated database retrieval system