KEGG   Streptomyces sp. 4F: ASR50_25650Help
Entry
ASR50_25650       CDS       T04265                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
strf  Streptomyces sp. 4F
Pathway
strf00250  Alanine, aspartate and glutamate metabolism
strf00280  Valine, leucine and isoleucine degradation
strf00410  beta-Alanine metabolism
strf00640  Propanoate metabolism
strf00650  Butanoate metabolism
strf01100  Metabolic pathways
strf01120  Microbial metabolism in diverse environments
Module
strf_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:strf00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ASR50_25650
   00650 Butanoate metabolism
    ASR50_25650
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ASR50_25650
   00280 Valine, leucine and isoleucine degradation
    ASR50_25650
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ASR50_25650
Enzymes [BR:strf01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ASR50_25650
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     ASR50_25650
Amino acid related enzymes [BR:strf01007]
 Aminotransferase (transaminase)
  Class III
   ASR50_25650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ALV52464
UniProt: A0A0U3Q3X9
Position
complement(5696142..5697476)
Genome map
AA seq 444 aa AA seqDB search
MTALPQERRVVTAIPGPKSQELQARRTAAVAQGVGSVLPVFTARAGGGIIEDVDGNRLID
FGSGIAVTSVGASAEAVVRRASAQLADFTHTCFMVTPYEGYVAVAEALAELTPGDHAKKS
ALFNSGAEAVENAVKIARAYTKRQAVVVFDHGYHGRTNLTMALTAKNMPYKHGFGPFAPE
VYRVPVAYGYRWPTGPENAGPEAAAQAIDEMSKQVGAENIAAIIIEPVLGEGGFIEPAKG
FLPAISEFAKDNGIVFVADEIQSGFCRTGQWFACEDEGIVPDLITTAKGIAGGLPLAAVT
GRAEIMDAAHSGGLGGTYGGNPVACAGALGAIETMKELDLNARAKRIEEVMKGRLTAMAE
KFDIIGDVRGRGAMIAIELVKDRATKEPNPEATAALAKACHQEGLLVLTCGTYGNVLRFL
PPLVIGEDLLNEGLDIIEQAFTRV
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacttccgcaggagcgccgcgtcgtcaccgccatccccggcccgaagtcgcag
gagctgcaggcccgccgcaccgccgcggtcgcgcagggcgtgggctccgtgctgcccgtg
ttcaccgcgcgggccggcggcggcatcatcgaggacgtcgacggcaaccgcctgatcgac
ttcggctccggcatcgccgtgacctccgtcggcgcgtccgccgaggccgtcgtccgccgc
gcctccgcgcagctcgccgacttcacccacacctgtttcatggtgacgccgtacgagggc
tacgtggccgtcgccgaggcgctcgccgagctgacgccgggtgaccacgcgaagaagtcc
gcgctgttcaacagcggcgccgaggccgtcgagaacgccgtgaagatcgcccgcgcctac
accaagcggcaggcggtcgtcgtgttcgaccacggctaccacggccgcaccaacctcacg
atggcgctgaccgcgaagaacatgccgtacaagcacggcttcggtccgttcgcgcccgag
gtgtaccgcgtgccggtcgcctacggctaccgctggcccaccggcccggagaacgcgggc
ccggaggccgccgcgcaggccatcgacgagatgtccaagcaggtcggcgccgagaacatc
gccgcgatcatcatcgagccggtgctcggcgagggcggcttcatcgagccggcgaagggc
ttcctgccggcgatcagcgagttcgccaaggacaacggcatcgtcttcgtggccgacgag
atccagtccggcttctgccgcaccggccagtggttcgcctgcgaggacgagggcatcgtc
cccgacctgatcaccacggcgaagggcatcgcgggcggtctgccgctcgccgccgtcacc
ggccgcgcggagatcatggacgccgcgcactccggcggcctgggcggcacctacggcggc
aacccggtggcctgcgcgggtgcgctcggcgccatcgagacgatgaaggagctggacctc
aacgcccgcgccaagcggatcgaggaggtcatgaagggccgcctgaccgccatggcggag
aagttcgacatcatcggcgacgtccggggccgcggcgcgatgatcgcgatcgagctggtc
aaggaccgcgccaccaaggagccgaacccggaggccacggccgcgctggcgaaggcctgc
caccaggagggcctgctggtcctgacctgtggcacctacggcaacgtgctgcgtttcctg
ccgccgctggtcatcggcgaggacctgctgaacgagggcctcgacatcatcgagcaggcc
ttcacccgcgtctga

DBGET integrated database retrieval system