KEGG   Streptacidiphilus sp. DSM 106435: C7M71_002535Help
Entry
C7M71_002535      CDS       T05561                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
stri  Streptacidiphilus sp. DSM 106435
Pathway
stri00625  Chloroalkane and chloroalkene degradation
stri00680  Methane metabolism
stri01100  Metabolic pathways
stri01120  Microbial metabolism in diverse environments
stri01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:stri00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    C7M71_002535
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    C7M71_002535
Enzymes [BR:stri01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     C7M71_002535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_N_assoc Glu_dehyd_C HI0933_like AlaDh_PNT_C FAD_oxidored Shikimate_DH FAD_binding_3 DAO Pyr_redox_3 ADH_zinc_N_2 FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AXI76514
UniProt: A0A345SS09
Position
complement(563103..564257)
Genome map
AA seq 384 aa AA seqDB search
MKALVYEGPRSVKVKDVPDARIERPTDVLVRITATNICGSDLHMYEGRTDMETGRTLGHE
NLGEVVEVGDAVDRVRVGDLVCLPFNISCGFCRNCEQGLTAFCLSTNPDPRMAGAAYGFA
GMGPYSGGQAELLRVPYGDHNCLVLPEDARERQTDYVMLSDIFPTGWHCTELAGVLPGET
VVIYGAGPVGLMAALSATLKSAEKVLVVDRHPDRLALAEQIGAIPVDDSKVSPIDRVLEE
TGGLGADCGCECVGYQAHDPQGQEHPNLTLNNLVQSVRFAGRIGVVGVFVPQDPHSPDQL
YRQGEVAFDYGLFWFKGQSVGNGQCNVKAYNRRLRNLVHSGKAKPSWIVSHEIPLEEAPE
AYRHFDARDDGWTKVVLHPGGTTR
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcactggtctacgaagggccgcgcagcgtcaaggtcaaggacgtgcccgacgcg
cggatagaacggccgaccgatgtgctggtgagaatcaccgccaccaatatctgcggctcg
gacctgcatatgtacgagggcaggaccgacatggagaccggccgcaccctcggccacgag
aacctgggcgaggtcgtggaggtgggcgacgccgtcgaccgggtgcgcgtgggcgacctg
gtctgtctgccgttcaacatctcctgcggcttctgccgcaactgcgagcagggcctgacc
gccttctgcctgagcaccaaccccgacccccggatggccggtgccgcctacgggttcgcg
ggcatgggaccgtactccggcggccaggcggagctgctgcgggtgccctacggcgaccac
aactgcctggtgctgcccgaggacgcacgggagcggcagaccgactatgtgatgctctcc
gacatcttcccgaccggctggcactgcaccgagctggccggggtgctgcccggcgagacc
gtggtgatctacggcgccggtccggtcggcctgatggccgctctgtccgcgaccctgaag
agcgccgagaaggtcttggtggtggaccggcacccggaccgcctggccctggccgagcag
atcggcgcgatcccggtggacgactccaaggtctcccccatcgaccgggtgcttgaggag
accggcgggctcggcgccgactgcggctgcgagtgcgtcgggtaccaggcccacgatccg
cagggccaggagcaccccaacctcaccctcaacaacctggtccagtcggtgcgcttcgcc
ggccgcatcggcgtggtcggggtcttcgtcccccaggacccgcacagcccggaccagctc
taccggcagggcgaagtcgccttcgactacggcctgttctggttcaaggggcagagcgtg
ggcaacggccagtgcaacgtcaaggcgtacaaccgccgactgcgcaacctggtccactcg
ggcaaggccaagccgtcctggatcgtctcccatgagatcccgctggaggaggcgcccgag
gcgtaccggcacttcgacgcgcgtgacgacggctggaccaaggtcgtcctgcaccccggt
ggcaccacccgctga

DBGET integrated database retrieval system