KEGG   Streptacidiphilus sp. DSM 106435: C7M71_003675Help
Entry
C7M71_003675      CDS       T05561                                 

Definition
(GenBank) low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
stri  Streptacidiphilus sp. DSM 106435
Pathway
stri00260  Glycine, serine and threonine metabolism
stri01100  Metabolic pathways
stri01110  Biosynthesis of secondary metabolites
stri01120  Microbial metabolism in diverse environments
stri01130  Biosynthesis of antibiotics
stri01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:stri00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C7M71_003675
Enzymes [BR:stri01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     C7M71_003675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Transket_pyr
Motif
Other DBs
NCBI-ProteinID: AXI81142
UniProt: A0A345T587
Position
complement(827474..828556)
Genome map
AA seq 360 aa AA seqDB search
MNDPFPTRTDAVRLHDPAVRGFASDNYAGVHPEILAALAVANGGHQIAYGEDDYTAHLQD
VFRRHFGDRAQAYPVFNGTGANVVALQALLPRWGAVVAAESAHINVDECGAPEKIAGIKL
LTVPTPDGKLTPELIDRQAWGWGDEHRAQPLAVSLTQSTELGTCYTADEIRAICDHAHER
GMLVHVDGSRIANAAATLDLPLRAFTSDAGVDVLSFGGTKNGLLLGEAVVVLNPDRVRDL
TYLRKMSMQLASKMRFVSVQFEALLGGDLWLRNASHANAMARRLEAAVRTIDGVEVVRPV
QANAVFALLPREVSERLQKRYRFYFWDEHTGEVRWMAAFDTTEADIDAFAAAIAEEMGRQ
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaccccttcccgacccggaccgacgcggtacgcctgcacgaccccgccgtacgc
ggcttcgccagcgacaactacgccggagtgcacccggagatcctggccgccctcgccgtc
gccaacggcggccaccagatcgcctatggcgaggacgactacaccgcgcacctccaggac
gtcttccgccgccacttcggcgaccgcgcccaggcctacccggtcttcaacggcaccgga
gccaatgtcgtcgccctccaggcgctgctgccccgctggggcgccgtcgtcgccgccgag
agcgcccacatcaacgtcgacgagtgcggcgcccccgagaagatcgcgggcatcaagctg
ctcaccgtccccacccccgacggcaagctcacccccgagctcatcgaccgccaggcctgg
ggctggggcgacgagcaccgcgcccagccgctcgccgtctccctcacccagagcaccgag
ctgggcacctgctacaccgccgacgagatcagggccatctgcgaccacgcccatgagcgc
ggcatgctggtccatgtcgacggctcccggatcgccaacgccgccgccaccctggacctg
ccgctgcgcgccttcaccagcgacgcgggcgtggatgtgctctccttcggcggcaccaag
aacgggctgctgctcggcgaggccgtggtggtgctcaaccccgaccgggtacgggacctg
acctatctgcgcaagatgtcgatgcagctcgcctccaagatgcgctttgtctcggtgcag
ttcgaggcgctgctcggcggcgacctctggctgcgcaacgcctcccacgccaatgccatg
gccaggcgcctggaggcggccgtgcgcaccatcgacggggtggaggtcgtccggccggtg
caggccaacgcggtcttcgcgctgctgccgcgcgaggtcagcgagcggttgcagaagcgc
taccgcttctacttctgggacgagcacaccggcgaggtccgctggatggcggccttcgac
accaccgaggccgacatcgacgccttcgccgccgccatcgcggaggagatgggcaggcag
tag

DBGET integrated database retrieval system