KEGG   Streptacidiphilus sp. DSM 106435: C7M71_013735Help
Entry
C7M71_013735      CDS       T05561                                 

Definition
(GenBank) L-2-hydroxyglutarate oxidase
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
stri  Streptacidiphilus sp. DSM 106435
Pathway
stri00310  Lysine degradation
stri01100  Metabolic pathways
stri01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:stri00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    C7M71_013735
Enzymes [BR:stri01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     C7M71_013735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO NAD_binding_8 FAD_binding_3 FAD_binding_2 Thi4 Lycopene_cycl Mqo Pyr_redox_2 Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: AXI78338
UniProt: A0A345SX83
Position
3104984..3106225
Genome map
AA seq 413 aa AA seqDB search
MAYDYDVLVVGGGIVGLATAYALVRGRPGLAVGVLEKEDFLASHQTGRNSGVIHSGVYYR
PGSFKARFAVGGAAEMVEFCREHGIAYEVTGKLIVAVDREELPRLHALAQRGRENGIPVR
ELGAAQIGDFEPHVAGVAGLHVGSTGICDFPAVARTLAKLAEEAGAELRPATEARSVAHR
ADGVTVGTRRGELRAGVLVNCAGLQSDRVARLAGDDPGVRIVPFRGEYYTLAPERQGLVR
GLVYPVPDPAFPFLGVHLTRGVHGEVHVGPNAVPALAREGYDWRTVRLRDVADTVAYPGT
WRVARRHWRYEVGELHRSLSKRAFTAAVRRLLPEVSAGDLVPAAAGVRAQAVARDGSLLD
DFAFAGFDPEARAAAPSRLVHVLNAPSPAATASLPIGREVARRALAALDAGRG
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtggcgtacgactacgacgtgctggtggtcggcggcgggatcgtcgggctggcgacggcg
tatgcgctggtgcgggggcggccggggctggcggtgggggtgctggagaaggaggacttc
ctggcctcgcaccagacggggcgcaacagcggggtgatccacagcggggtgtactaccgg
ccggggtcgttcaaggcccggttcgcggtgggcggtgcggcggagatggtggagttctgc
cgggagcacgggatcgcgtacgaggtgaccgggaagctgatcgtggcggtggaccgggag
gagctgccccggttgcatgcgctggcgcagcggggccgggagaacggcatcccggtgcgg
gagctgggggcggcgcagatcggcgatttcgagccacatgtggcgggggtggcggggctg
catgtggggtcgacggggatctgcgacttcccggcggtggcgcgtaccctcgccaagctc
gcggaggaggcgggggccgagctgcggccggcgaccgaggcgcggtcggtggcgcaccgg
gcggacggggtgacggtggggacgcgccggggcgagctgcgggccggggtgctggtgaac
tgcgccgggctgcagagcgaccgggtggcgcggctggccggggacgatccgggggtgcgg
atcgtgccgttccggggtgagtactacaccttggcgccggagcggcaggggctggtgcgg
gggctggtgtatccggtgccggacccggcgttcccgttcctgggggtgcatctgacgcgg
ggcgtgcacggggaggtgcatgtggggcccaatgcggtgccggcgctggcccgggagggc
tatgactggcggacggtgcggctgcgggatgtggcggacacggtcgcgtacccggggacc
tggcgggtcgcgcggcggcactggcggtacgaggtgggcgagttgcaccgctcgctgtcc
aagcgggcgttcacggcggccgtacggcggctgctgccggaggtgtcggcgggggatctg
gtgccggccgcggcgggggtgcgggcgcaggcggtggcgcgggacgggtcgctgctggac
gacttcgcgttcgcgggtttcgacccggaggcgagggctgcggcgccgtcccggctggtg
catgtgctgaacgcgccgtccccggcggcgaccgcttcgctgccgatcggccgggaggtg
gcacggcgggcgctggcggcgctggacgcgggccgggggtag

DBGET integrated database retrieval system