KEGG   Streptacidiphilus sp. DSM 106435: C7M71_018455Help
Entry
C7M71_018455      CDS       T05561                                 

Definition
(GenBank) class II aldolase/adducin family protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
stri  Streptacidiphilus sp. DSM 106435
Pathway
stri00051  Fructose and mannose metabolism
stri01100  Metabolic pathways
stri01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:stri00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    C7M71_018455
Enzymes [BR:stri01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     C7M71_018455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AXI79103
UniProt: A0A345SZE8
Position
4138956..4139609
Genome map
AA seq 217 aa AA seqDB search
MLLAEARAEIVRHARRLRPDGLVVGTAGNLSVRVGELLAVTPSGVDYDELTPELIGVHRM
DGTAVEAELPPSSELPFHLAAYRAEGAAAVVHTHSVAATAVACLDGLSQLPPVHYYTAMF
GGPLRIAPYETYGSAELAAGVEAALAGGRRGCLLANHGAVTVAGSLAAAYGLAQQLEWMC
DVYLRTRAAGLPRALDAVQLEQATAKLAGYGRSQPGS
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
gtgctgcttgccgaggctcgcgccgagatcgtccgtcatgcccggcggctgcgcccggac
gggctggtcgtgggcactgcgggcaacctctcggtccgggtcggtgagctgctggcggtc
acccccagcggtgtggactacgacgaactgacgccggagctgatcggcgtgcaccggatg
gacggcaccgccgtcgaggccgaactgccgcccagcagcgagctgcccttccatctggcc
gcctaccgggccgagggcgccgccgcggtggtgcacacccactcggtggccgccaccgcc
gtcgcctgcctggacgggctgtcgcaactgccgccggtccactactacacggcgatgttc
ggtggcccgctgcggatcgcgccgtacgagacctacggcagtgcggaactggcagccgga
gtcgaggcggcgctggccggtggccgccggggctgcctgctggccaaccacggcgcggtg
acggtggccggcagcctcgcggcggcctatgggctggcgcagcagctggagtggatgtgc
gatgtctatctgcgcacccgggcggccggcctgcccagggcgctggacgcggtccagttg
gagcaggcgaccgccaagctggccgggtacggccgttcccagccggggagttga

DBGET integrated database retrieval system