KEGG   Streptacidiphilus sp. DSM 106435: C7M71_023675Help
Entry
C7M71_023675      CDS       T05561                                 

Gene name
pruA
Definition
(GenBank) L-glutamate gamma-semialdehyde dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
stri  Streptacidiphilus sp. DSM 106435
Pathway
stri00250  Alanine, aspartate and glutamate metabolism
stri00330  Arginine and proline metabolism
stri01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stri00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    C7M71_023675 (pruA)
   00330 Arginine and proline metabolism
    C7M71_023675 (pruA)
Enzymes [BR:stri01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     C7M71_023675 (pruA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF2007
Motif
Other DBs
NCBI-ProteinID: AXI79953
UniProt: A0A345T1U8
Position
5355612..5357237
Genome map
AA seq 541 aa AA seqDB search
MDAVTQVPAPVNEPVHSYAPGSPERARLEAELKRLAAEPVELTMAIGGQRRLGGGEPIEV
VQPHRHAARLGTMRNATREDARAAVDAALAAAPAWRALSFDDRAAVFLRAADLLAGPWRE
TIAAATMLGQSKTAQQAEIDSPCELVDFWRFNVHFARQVMAEQPVSSPGVWNRSDHRPLE
GFVYAVTPFNFTAIAGNLPTAPALMGNVVVWKPSPTQQLAAHLLMGLLEEAGLPAGVVNM
VTGDGLAVSEVALAHPELAGIHFTGSTATFQHLWRTVGENIAGYRSYPRLVGETGGKDFI
VAHPSADPAVLRTAMVRGAFEFQGQKCSAASRAYVPASLWERIREELRQEVEGLTMGDVT
DLSHFMGAVIDARSFARNKAALDRAHADPTVEVLAGGTCDDSVGYFVRPTVLVGTDPGAE
YFREEYFGPILAVHVYEDERYEEMLDQMESASPYALTGAVIAQDRAAVAHTMERLRFAAG
NFYINDKPTGAVVGQQPFGGGRASGTNDKAGAAQNLLRWTSTRSIKETFVPPTDYRYPHM
G
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggacgctgtgacccaggtccccgcaccggtgaacgagccggtccacagctacgccccc
ggcagtccggagcgggcccggttggaggcggagctgaagcggctcgcggcggagccggtc
gagctgaccatggccatcggcgggcagcggcggctgggcggcggtgagccgatcgaggtg
gtgcagccgcatcggcatgcggcgcggctgggcacgatgcgcaatgcgacccgggaggat
gcgcgggctgcggtggatgcggcgctggcggcggctccggcgtggcgggcgctgtcgttc
gacgaccgggcggcggtcttcctgcgggcggcggacctgctggccggtccgtggcgggag
acgatcgcggcggcgacgatgctggggcagtccaagaccgcgcagcaggcggagatcgac
agtccgtgcgagctggtggacttctggcgtttcaatgtgcacttcgcgcggcaggtgatg
gcggagcagccggtgtcctcgccgggggtgtggaaccgcagtgaccatcggccgctggag
ggtttcgtctatgcggtcacgccgttcaacttcacggcgatcgcggggaacctgccgacc
gctccggcgctgatgggcaatgtggtggtctggaagccgtcgccgacgcagcagttggct
gcgcatctgctgatggggctgctggaggaggcggggctgccggcgggtgtggtcaatatg
gtgacgggtgacggtctggcggtctccgaggtggccttggcccatccggagctggccggg
atccacttcaccgggtccacggcgaccttccagcacctgtggcggacggtgggggagaac
atcgccgggtaccggtcctatccgcggctggtgggggagaccgggggcaaggacttcatc
gtggcgcatccttcggccgatccggcggtgctgaggacggcgatggtccggggtgcgttc
gagttccagggccagaagtgctcggccgcctcccgcgcctatgtgcccgcctcgctgtgg
gagcggatcagggaggagctgcggcaggaggtggaggggctgacgatgggcgatgtgacc
gacctgtcgcacttcatgggcgcggtcatcgacgcccgctccttcgcccggaacaaggcc
gccctcgaccgcgcccacgccgacccgaccgtggaggtcctggcgggcggcacctgcgac
gacagcgtcgggtactttgtgcggccgacggtgctggtgggcaccgacccgggcgccgag
tacttccgcgaggagtacttcggcccgatcctggccgtgcacgtctacgaggacgagcgc
tacgaggagatgctggaccagatggagtccgcctccccgtacgcgctgaccggcgccgtg
atcgcccaggaccgcgccgccgtcgcccacaccatggagcggctgcggttcgccgcgggc
aacttctacatcaacgacaagcccaccggcgccgtcgtcggccagcagcccttcggcggc
ggccgcgcctccggcaccaacgacaaggccggcgcagcgcagaacctgctccgctggacc
tccacccgctccatcaaggagaccttcgtcccgccgaccgactaccgctacccccacatg
ggctga

DBGET integrated database retrieval system