KEGG   Streptomyces sp. Mg1: M444_06695Help
Entry
M444_06695        CDS       T03958                                 

Definition
(GenBank) polyprenyl synthetase
  KO
K13787  geranylgeranyl diphosphate synthase, type I [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
strm  Streptomyces sp. Mg1
Pathway
strm00900  Terpenoid backbone biosynthesis
strm01100  Metabolic pathways
strm01110  Biosynthesis of secondary metabolites
Module
strm_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:strm00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    M444_06695
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:strm01006]
    M444_06695
Enzymes [BR:strm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     M444_06695
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     M444_06695
    2.5.1.29  geranylgeranyl diphosphate synthase
     M444_06695
Prenyltransferases [BR:strm01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   M444_06695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: AKL65127
UniProt: A0A0G3UFF6
Position
1:1648575..1649609
Genome map
AA seq 344 aa AA seqDB search
MHDHTGFKERVDGVLVRLADEEEETLLALHTELFPLAEQLRRSLARGKRIRAAFLYWGWR
AAGQPDCEAVIRAAAAMELVHAAACTHDDIIDGSRMRHGQLTAHASFDAAGQRSTALAMI
LGDLLMGYAGHLFTSCGLPGAYLARTVPLWTTLLRETMAGEFLEVLRTSAAPAREPRVAE
SLEVARYKTAKYTVERPLQLGSTLGGGPGALSEAFSAYGLPLGEAFQLRDDLLGTFGDPA
RTGKSNLDDLRGGKPTTLLALTLEAAGEDDRRLLAKLVGNPELVPEEAASVRELMDRCGA
RQRVEDMIRDRIGRAAAALETVPMPAEARSALRELAGTAADRSL
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
gtgcatgaccacaccggcttcaaggagcgcgtggacggggtactggtccggctggccgac
gaggaggaggagaccctcctcgccctgcacaccgaactcttccctctggccgagcagttg
cgccggtcgctggcgcgcggcaagcggatccgcgcggcgttcctgtactggggctggcgg
gccgccgggcagcccgactgcgaggcggtgatccgggccgcggccgcgatggaactcgtc
cacgcggcggcctgcacccacgacgacatcatcgacggcagccggatgcggcacggccag
ctcaccgcgcacgcctccttcgacgccgccggacagcgctccaccgccctcgcgatgatc
ctcggcgatctgctgatgggctacgcgggtcacctgttcacctcctgcgggctgcccggg
gcctacctggcgcggaccgtgccgctctggaccaccctgctgcgcgagacgatggccggg
gagttcctggaggtgctgcgcacctccgccgcgccggcccgggaaccgcgggtggcggag
tcgctggaggtggcccgctacaagaccgccaagtacacggtggagcggccgctgcagctc
ggctccaccctcggcggcggccccggcgccctgtccgaggcgttctccgcgtacgggctg
ccgctgggcgaggccttccagctgcgcgacgacctgctcggcaccttcggggacccggcc
cggacgggcaagtcgaacctggacgacctgcgcggcgggaagcccaccacgctgctcgcc
ctgaccctggaggcggccggggaggacgaccggcggctcctcgccaagctggtgggcaac
ccggagctggtcccggaagaggcggcgtccgtacgggagctgatggaccgctgcggggcc
cggcagcgggtcgaggacatgatccgggaccggatcggccgggccgccgccgcgctggag
accgtaccgatgccggcggaggcacggtccgcgctgcgcgagctggcgggcacggccgcc
gaccgctcgctctag

DBGET integrated database retrieval system