KEGG   Streptomyces sp. Mg1: M444_09645Help
Entry
M444_09645        CDS       T03958                                 

Definition
(GenBank) cobalamin biosynthesis protein CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
strm  Streptomyces sp. Mg1
Pathway
strm00860  Porphyrin and chlorophyll metabolism
strm01100  Metabolic pathways
Module
strm_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:strm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    M444_09645
Enzymes [BR:strm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     M444_09645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 GATase SNO Peptidase_S51 DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: AKL69902
UniProt: A0A0G3UU10
Position
1:2292468..2293988
Genome map
AA seq 506 aa AA seqDB search
MSGAKRGGGLLVAGTTSDAGKSVVTAGICRWLVRQGVKVAPFKAQNMSLNSFVTREGAEI
GRAQAMQAQAARVEPTALMNPVLLKPGSDQSSQVVLLGKAVGEMSARGYHGGRQERLLGV
VTDCLEQLRGTYDAVICEGAGSPAEINLRRTDIVNMGIARAARFPVVVVGDIDRGGVFAS
FFGTTALLSPGDQSLIAGYMVNKFRGDVSLLEPGMEMLRGLTGRATYGVLPFRHGLGIDE
EDGLRVSLRGAVRESVVAPPVGEDVLRVAVCAVPLMSNFTDVDALAAEPGVVVRFVDRAE
ELTDADLVVVPGTRGTVKALRWLRERGLADALLRRAAEGRPVLGICGGFQALGEHIEDEV
ESRAGSVEGLGLLPVRVRFEREKTLARPVGSALGEPVTGYEIHHGVAEVLGGESFLDGCR
VGSVWGTHWHGSLESDGFRRAFLREVAAAAGRRFVPAPDTSFGELREEQLDLLGDLIEEH
ADTRALLELIETGAPPGLPFLPPGAP
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgcgaagcggggcgggggactcctcgtcgccggaacgacatcggacgcgggc
aagagcgtggtcacggccggcatctgccgctggctggtccgccagggcgtcaaggtggcg
ccgttcaaggcgcagaacatgtcgctgaactcgttcgtgacgcgcgagggcgccgagatc
gggcgggcacaggcgatgcaggcgcaggccgcgcgcgtggagccgacggcgctgatgaac
ccggtgctgctcaagccgggcagtgaccagagcagccaggtggtgctgctgggcaaggcg
gtgggcgagatgagcgcgcgcggctaccacgggggccgccaggaacggctcctcggtgtc
gtcacggactgcctggagcagctgcggggcacgtatgacgccgtgatctgcgagggggcg
ggcagtccggccgagatcaacctgcggcggacggacatcgtgaacatggggatcgcgcgg
gccgcgcgcttcccggtggtcgtggtcggcgacatcgaccggggcggcgtcttcgcgtcg
ttcttcgggacgacggcgctgctctcccccggggaccagtccctgatcgccggctacatg
gtgaacaagttccgcggcgacgtctcgctgctggagcccggcatggagatgctgcgcggg
ctgacgggtcgggccacgtacggcgtgctgccgttccggcacgggctgggcatcgacgag
gaggacgggctgcgcgtctccctgcggggcgccgtccgcgagtcggtggtggccccgccg
gtcggcgaggacgtactgcgggtcgcggtgtgcgcggtgccgctgatgtcgaacttcacg
gacgtggacgcgctcgcggcggagccgggggtcgtggtgcggttcgtggaccgggccgag
gagctgaccgacgcggacctggtcgtcgtacccggcacccgcggcacggtgaaggccctg
cgctggctgcgggaacgcggcctcgcggacgcgctgctgcggcgggccgccgaggggcgg
ccggtcctgggcatttgcggcggcttccaggcgctgggggagcacatcgaggacgaggtc
gaatcgcgggcgggatccgtggaggggctcgggctgctgccggtacgggtccgcttcgaa
cgggagaagaccctggcgcgtccggtcggctccgcgctgggcgagccggtgacggggtac
gagatccaccacggggtcgccgaggtgctgggcggggagtcgttcctggacgggtgccgg
gtggggtcggtgtggggcacgcactggcacggctcgctggagtcggacggcttccggcgg
gcgttcctccgcgaggtggccgcggccgccgggcgccgcttcgtcccggcccccgacacg
tccttcggggagctgcgcgaggaacagctggacctgctgggcgacttgatcgaggaacac
gccgacacgcgtgcgctgctggagctgatcgagaccggagccccgcccggcctcccgttc
ctccccccgggcgcgccgtga

DBGET integrated database retrieval system