KEGG   Streptomyces sp. Mg1: M444_36330Help
Entry
M444_36330        CDS       T03958                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
strm  Streptomyces sp. Mg1
Pathway
strm00670  One carbon pool by folate
strm01100  Metabolic pathways
strm01120  Microbial metabolism in diverse environments
strm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:strm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    M444_36330
Enzymes [BR:strm01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     M444_36330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR ALG11_N
Motif
Other DBs
NCBI-ProteinID: AKL70822
UniProt: B4V6E8
Position
pSMg1-1:complement(381380..382279)
Genome map
AA seq 299 aa AA seqDB search
MSGLRELLASGQRSFSFEFFPPKTDAGERVLWNAIRRIEAMAPSFVSVTYGAGGSSRDRT
VEVTKRMVAETTLLPVAHLTAVGHSVAELRHIIGQYADAGVRDVLALRGDPPGNPNATWT
AHPQGLRHADELVSLVRASGDFSVGVAAFPEMHPRSPDWDTDIRHFVAKCRAGADYAITQ
MFFHVEDYLRLRDRVAAAGCDTPIIPEIMPATDARQIGRFAELSGAAFPEELAGRLEAAK
DNPADGHRIGVEYATAMADRLLAEGAPGLHYITLNRSTATLEIHQNIIESRSAHALAHG
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcctgcgcgaactgctggcgagcggacagcgatcgttctccttcgagttcttc
ccgcccaagacggacgccggcgagcgcgtcctgtggaacgccatccgccggatcgaggcg
atggctccgtcgttcgtctccgtcacctacggggccggcggttcctcgcgcgaccggacc
gtcgaggtgaccaagcggatggtcgccgagaccactctgctgcccgtggcgcacctgacg
gccgtcgggcactcggtggccgagctgcgccacatcatcggccagtacgcggacgccggc
gtgcgcgacgtactcgccctgcgcggcgatccgccgggcaacccgaacgccacctggacg
gcgcacccccagggcctgcgccacgccgacgaactggtctccctggtccgggcctcgggc
gacttcagcgtcggggtcgccgccttccccgagatgcacccgcgctcgcccgactgggac
accgacatccggcacttcgtcgccaagtgccgggcgggcgccgactacgccatcacccag
atgttcttccacgtcgaggactacctgcggctgcgcgaccgggtggccgccgccggctgc
gacaccccgatcatcccggagatcatgcccgccaccgatgcccgccagatcggccgcttc
gccgaactcagcggcgcggccttccccgaagagctggccggacggctcgaagccgcgaag
gacaacccggccgacgggcaccgcatcggcgtcgagtacgccacggcgatggccgaccgg
ctcctcgccgaaggcgcaccgggcctgcactacatcaccctcaaccgctcgaccgccacg
ctagagatccaccagaacatcatcgaatcaaggagcgcacatgccctcgcccacggctga

DBGET integrated database retrieval system